DLK-1/Pref-1 recombinant protein
Human DLK-1/Pref-1
Protein Sequence: AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQ CICTDGWDGELCDRDVRACSSAPCANNGTCVSLDDGLYECSCAPGYSGKD CQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANS CTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTC LQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVH ELPVQQPEHRILKVSMKELNKKTPLEHHHHHH
NCBI and Uniprot Product Information
NCBI Description
This gene encodes a transmembrane protein containing six epidermal growth factor repeats. The protein is involved in the differentiation of several cell types, including adipocytes; it is also thought to be a tumor suppressor. It is one of several imprinted genes located in a region of on chr 14q32. Certain mutations in this imprinted region can cause phenotypes similar to maternal and paternal uniparental disomy of chromosome 14 (UPD14). This gene is expressed from the paternal allele. A polymorphism within this gene has been associated with child and adolescent obesity. The mode of inheritance for this polymorphism is polar overdominance; this non-Mendelian inheritance pattern was first described in sheep with the callipyge phenotype, which is characterized by muscle hypertrophy and decreased fat mass. [provided by RefSeq, Mar 2010]
Uniprot Description
DLK1: May have a role in neuroendocrine differentiation. Monomer. Found within the stromal cells in close contact to the vascular structure of placental villi, yolk sac, fetal liver, adrenal cortex and pancreas and in the beta cells of the islets of Langerhans in the adult pancreas. Found also in some forms of neuroendocrine lung tumor tissue. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 14q32
Cellular Component: extracellular space; integral to membrane; external side of plasma membrane
Biological Process: Notch signaling pathway; regulation of gene expression; embryonic skeletal development; multicellular organismal development; negative regulation of Notch signaling pathway; cell differentiation; post-embryonic development
Research Articles on DLK-1/Pref-1
Similar Products
Product Notes
The DLK-1/Pref-1 dlk1 (Catalog #AAA692217) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Human DLK-1/Pref-1 reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: N-Terminal Sequence: AECFP P rotein Sequence: AECFPACNPQ NGFCEDDNVC RCQPGWQGPL CDQCVTSPGC LHGLCGEPGQ CICTDGWDGE LCDRDVRACS SAPCANNGTC VSLDDGLYEC SCAPGYSGKD CQKKDGPCVI NGSPCQHGGT CVDDEGRASH ASCLCPPGFS GNFCEIVANS CTPNPCENDG VCTDIGGDFR CRCPAGFIDK TCSRPVTNCA SSPCQNGGTC LQHTQVSYEC LCKPEFTGLT CVKKRALSPQ QVTRLPSGYG LAYRLTPGVH ELPVQQPEHR ILKVSMKELN KKTPLEHHHH HH. It is sometimes possible for the material contained within the vial of "DLK-1/Pref-1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.