Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit MAP Kinase p44/42 Polyclonal Antibody

MAP Kinase p44/42, CT (MAPK3/MAPK1, Mitogen-activated Protein Kinase 1, MAP Kinase 1, MAPK 1, Mapk, ERT1, Extracellular Signal-regulated Kinase 2, ERK-2, MAP Kinase Isoform p42, p42-MAPK, Mitogen-activated Protein Kinase 2, MAP Kinase 2, MAPK 2, ERK2, PRK

Reactivity
Rat, Chicken, Human, Mouse
Applications
Western Blot, Immunoprecipitation
Purity
Purified by Immunoaffinity chromatography.
Synonyms
MAP Kinase p44/42; Polyclonal Antibody; CT (MAPK3/MAPK1; Mitogen-activated Protein Kinase 1; MAP Kinase 1; MAPK 1; Mapk; ERT1; Extracellular Signal-regulated Kinase 2; ERK-2; MAP Kinase Isoform p42; p42-MAPK; Mitogen-activated Protein Kinase 2; MAP Kinase 2; MAPK 2; ERK2; PRK; EC=2.7.11.24; anti-MAP Kinase p44/42 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Rat, Chicken, Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes rat MAPK1/Erk1 at 44kD and MAPK2/Erk2 at 42kD. Species Crossreactivity: Human, mouse, chicken and starfish. Species Sequence Homology: Chinese hamster: 35/35; mouse: 34/35; human: 32/35
Purity/Purification
Purified by Immunoaffinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase.
Applicable Applications for anti-MAP Kinase p44/42 antibody
Western Blot (WB), Immunoprecipitation (IP)
Application Notes
WB: 0.1-2ug/ml detects MAP kinases in RIPA lysates of mouse 3T3/A31 fibroblasts and L6 cells. 3T3/A31 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-MAP Kinase 1/2 (0.1ug/ml). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemilum-inescence detection system.
Applications are based on unconjugated antibody.
Immunogen
Synthetic peptide (CGG-PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-terminal 35 amino acids of rat 44kD MAP Kinase 2/ Erk2 (KLH coupled)
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-MAP Kinase p44/42 antibody
References
Boulton, T.G., et al., Science 249: 64-67, 1990. Blumer, K.J., and Johnson, G.L., Trends. Biochem. Sci. 19: 236-240, 1994.

Similar Products

Product Notes

The MAP Kinase p44/42 (Catalog #AAA6486704) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAP Kinase p44/42, CT (MAPK3/MAPK1, Mitogen-activated Protein Kinase 1, MAP Kinase 1, MAPK 1, Mapk, ERT1, Extracellular Signal-regulated Kinase 2, ERK-2, MAP Kinase Isoform p42, p42-MAPK, Mitogen-activated Protein Kinase 2, MAP Kinase 2, MAPK 2, ERK2, PRK reacts with Rat, Chicken, Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's MAP Kinase p44/42 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunoprecipitation (IP). WB: 0.1-2ug/ml detects MAP kinases in RIPA lysates of mouse 3T3/A31 fibroblasts and L6 cells. 3T3/A31 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-MAP Kinase 1/2 (0.1ug/ml). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemilum-inescence detection system. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAP Kinase p44/42 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAP Kinase p44/42, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.