Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of C20orf20 expression in transfected 293T cell line by C20orf20 polyclonal antibody. Lane 1: C20orf20 transfected lysate (22.44kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human MRGBP Polyclonal Antibody | anti-MRGBP antibody

MRGBP (C20orf20, MRG-binding Protein, MRG/MORF4L-binding Protein, FLJ10914)

Gene Names
MRGBP; Eaf7; URCC4; MRG15BP; C20orf20
Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
MRGBP; Polyclonal Antibody; MRGBP (C20orf20; MRG-binding Protein; MRG/MORF4L-binding Protein; FLJ10914); Anti -MRGBP (C20orf20; anti-MRGBP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human C20orf20.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICIRDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPHNGADDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGADKRKRSRVTDKVLTANSNPSSPSAAKRRRT
Applicable Applications for anti-MRGBP antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, Western Blot and Immunohistochemistry.
Dilution: Immunofluorescence: 10ug/ml
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Full length human C20orf20, aa1-204 (NP_060740.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of C20orf20 expression in transfected 293T cell line by C20orf20 polyclonal antibody. Lane 1: C20orf20 transfected lysate (22.44kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of C20orf20 expression in transfected 293T cell line by C20orf20 polyclonal antibody. Lane 1: C20orf20 transfected lysate (22.44kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of purified antibody to C20orf20 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of purified antibody to C20orf20 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to C20orf20 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of purified antibody to C20orf20 on HeLa cell. [antibody concentration 10ug/ml].)
Related Product Information for anti-MRGBP antibody
Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome -DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage.
Product Categories/Family for anti-MRGBP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,417 Da
NCBI Official Full Name
MRG/MORF4L-binding protein
NCBI Official Synonym Full Names
MRG/MORF4L binding protein
NCBI Official Symbol
MRGBP
NCBI Official Synonym Symbols
Eaf7; URCC4; MRG15BP; C20orf20
NCBI Protein Information
MRG/MORF4L-binding protein; MRG-binding protein; MRG(MORF4-related gene)-binding protein
UniProt Protein Name
MRG/MORF4L-binding protein
UniProt Gene Name
MRGBP
UniProt Synonym Gene Names
C20orf20
UniProt Entry Name
MRGBP_HUMAN

Uniprot Description

Function: Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage.

Subunit structure: Component of the NuA4 histone acetyltransferase complex which contains the catalytic subunit KAT5/TIP60 and the subunits EP400, TRRAP/PAF400, BRD8/SMAP, EPC1, DMAP1/DNMAP1, RUVBL1/TIP49, RUVBL2, ING3, actin, ACTL6A/BAF53A, MORF4L1/MRG15, MORF4L2/MRGX, MRGBP, YEATS4/GAS41, VPS72/YL1 and MEAF6. The NuA4 complex interacts with MYC and the adenovirus E1A protein. MRGBP may interact directly with MORF4L1/MRG15 and MORF4L2/MRGX. Ref.4

Subcellular location: Nucleus.

Sequence similarities: Belongs to the EAF7 family.

Research Articles on MRGBP

Similar Products

Product Notes

The MRGBP mrgbp (Catalog #AAA648189) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MRGBP (C20orf20, MRG-binding Protein, MRG/MORF4L-binding Protein, FLJ10914) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MRGBP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). Suitable for use in Immunofluorescence, Western Blot and Immunohistochemistry. Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the MRGBP mrgbp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGEAEVGGGG AAGDKGPGEA ATSPAEETVV WSPEVEVCLF HAMLGHKPVG VNRHFHMICI RDKFSQNIGR QVPSKVIWDH LSTMYDMQAL HESEILPFPN PERNFVLPEE IIQEVREGKV MIEEEMKEEM KEDVDPHNGA DDVFSSSGSL GKASEKSSKD KEKNSSDLGC KEGADKRKRS RVTDKVLTAN SNPSSPSAAK RRRT. It is sometimes possible for the material contained within the vial of "MRGBP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.