Western Blot (WB)
(Western Blot analysis of EXTL2 expression in transfected 293T cell line by EXTL2 polyclonal antibody. Lane 1: EXTL2 transfected lysate (37.5kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human EXTL2 Polyclonal Antibody | anti-EXTL2 antibody
EXTL2 (Exostosin-like 2, Alpha-1,4-N-acetylhexosaminyltransferase EXTL2, Alpha-GalNAcT EXTL2, EXT-related Protein 2, Glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase, EXTR2)
Gene Names
EXTL2; EXTR2
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
EXTL2; Polyclonal Antibody; EXTL2 (Exostosin-like 2; Alpha-1; 4-N-acetylhexosaminyltransferase EXTL2; Alpha-GalNAcT EXTL2; EXT-related Protein 2; Glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase; EXTR2); Anti -EXTL2 (Exostosin-like 2; anti-EXTL2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human EXTL2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MRCCHICKLPGRVMGIRVLRLSLVVILVLLLVAGALTALLPSVKEDKMLMLRREIKSQGKSTMDSFTLIMQTYNRTDLLLKLLNHYQAVPNLHKVIVVWNNIGEKAPDELWNSLGPHPIPVIFKQQTANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEMQAPGSGNGDQYSMVLIGASFFNSKYLELFQRQPAAVHALIDDTQNCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGYSGMWHRAEHALQRSYCINKLVNIYDSMPLRYSNIMISQFGFPYANYKRKI
Applicable Applications for anti-EXTL2 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human EXTL2, aa1-330 (NP_001028197.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of EXTL2 expression in transfected 293T cell line by EXTL2 polyclonal antibody. Lane 1: EXTL2 transfected lysate (37.5kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of EXTL2 expression in transfected 293T cell line by EXTL2 polyclonal antibody. Lane 1: EXTL2 transfected lysate (37.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-EXTL2 antibody
Glycosyltransferase required for the biosynthesis of heparan-sulfate and responsible for the alternating addition of beta-1-4-linked glucuronic acid (GlcA) and alpha-1-4-linked N-acetylglucosamine (GlcNAc) units to nascent heparan sulfate chains.
Product Categories/Family for anti-EXTL2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37,466 Da
NCBI Official Full Name
exostosin-like 2 isoform 1
NCBI Official Synonym Full Names
exostosin-like glycosyltransferase 2
NCBI Official Symbol
EXTL2
NCBI Official Synonym Symbols
EXTR2
NCBI Protein Information
exostosin-like 2; alpha-GalNAcT EXTL2; EXT-related protein 2; processed exostosin-like 2; exostoses (multiple)-like 2; alpha-1,4-N-acetylhexosaminyltransferase EXTL2; glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase
UniProt Protein Name
Exostosin-like 2
Protein Family
UniProt Gene Name
EXTL2
UniProt Synonym Gene Names
EXTR2
UniProt Entry Name
EXTL2_HUMAN
Uniprot Description
Function: Glycosyltransferase required for the biosynthesis of heparan-sulfate and responsible for the alternating addition of beta-1-4-linked glucuronic acid (GlcA) and alpha-1-4-linked N-acetylglucosamine (GlcNAc) units to nascent heparan sulfate chains. Ref.4
Catalytic activity: UDP-N-acetyl-D-glucosamine + beta-D-glucuronosyl-(1->3)-beta-D-galactosyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-xylosyl-proteoglycan = UDP + alpha-N-acetyl-D-glucosaminyl-(1->4)-beta-D-glucuronosyl-(1->3)-beta-D-galactosyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-xylosyl-proteoglycan.
Pathway: Glycan metabolism; heparan sulfate biosynthesis.
Subcellular location: Endoplasmic reticulum membrane; Single-pass type II membrane protein
By similarity Ref.3. Processed exostosin-like 2: Secreted. Note: A soluble form is found in the serum. Ref.3
Tissue specificity: Ubiquitous.
Post-translational modification: The soluble form derives from the membrane form by proteolytic processing.
Sequence similarities: Belongs to the glycosyltransferase 47 family.
Research Articles on EXTL2
Similar Products
Product Notes
The EXTL2 extl2 (Catalog #AAA646620) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EXTL2 (Exostosin-like 2, Alpha-1,4-N-acetylhexosaminyltransferase EXTL2, Alpha-GalNAcT EXTL2, EXT-related Protein 2, Glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase, EXTR2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EXTL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the EXTL2 extl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRCCHICKLP GRVMGIRVLR LSLVVILVLL LVAGALTALL PSVKEDKMLM LRREIKSQGK STMDSFTLIM QTYNRTDLLL KLLNHYQAVP NLHKVIVVWN NIGEKAPDEL WNSLGPHPIP VIFKQQTANR MRNRLQVFPE LETNAVLMVD DDTLISTPDL VFAFSVWQQF PDQIVGFVPR KHVSTSSGIY SYGSFEMQAP GSGNGDQYSM VLIGASFFNS KYLELFQRQP AAVHALIDDT QNCDDIAMNF IIAKHIGKTS GIFVKPVNMD NLEKETNSGY SGMWHRAEHA LQRSYCINKL VNIYDSMPLR YSNIMISQFG FPYANYKRKI. It is sometimes possible for the material contained within the vial of "EXTL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
