Mouse anti-Human PPP1R1C Monoclonal Antibody | anti-PPP1R1C antibody

PPP1R1C (Protein Phosphatase 1 Regulatory Subunit 1C, Inhibitor-5 of Protein Phosphatase 1, IPP5)

Cat. Num. AAA646021

• Gene Names: PPP1R1C; IPP5
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Ascites; Ascites
• Synonyms: PPP1R1C; Monoclonal Antibody; PPP1R1C (Protein Phosphatase 1 Regulatory Subunit 1C; Inhibitor-5 of Protein Phosphatase 1; IPP5); Anti -PPP1R1C (Protein Phosphatase 1 Regulatory Subunit 1C; anti-PPP1R1C antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgM,k
• Clone Number: 2G7
• Specificity: Recognizes human PPP1R1C.
• Purity/Purification: Ascites; Ascites
• Form/Format: Supplied as a liquid in ascites fluid.
• Sequence: MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTPASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRKQSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRDH

• Applicable Applications for anti-PPP1R1C antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Full length recombinant protein corresponding to aa1-109 from PPP1R1C (AH17943.1) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.1kD).)

Related Product Information for anti-PPP1R1C antibody

Protein phosphatase-1 (PP1) is a major serine/threonine phosphatase that regulates a variety of cellular functions. PP1 consists of a catalytic subunit (see PPP1CA; MIM 176875) and regulatory subunits that determine the subcellular localization of PP1 or regulate its function. PPP1R1C belongs to a group of PP1 inhibitory subunits that are themselves regulated by phosphorylation (Wang et al., 2008 [PubMed 18310074]).[supplied by OMIM].

Product Categories/Family for anti-PPP1R1C antibody

Antibodies; Abs to Enzymes; Phosphatase

NCBI and Uniprot Product Information

• NCBI GI #: 17389867
• NCBI GeneID: 151242
• UniProt Accession #: Q8WVI7; Q5HYJ5; Q8TD54
• Molecular Weight: 12,346 Da
• NCBI Official Full Name: PPP1R1C protein
• NCBI Official Synonym Full Names: protein phosphatase 1, regulatory (inhibitor) subunit 1C
• NCBI Official Symbol: PPP1R1C
• NCBI Official Synonym Symbols: IPP5
• NCBI Protein Information: protein phosphatase 1 regulatory subunit 1C; PP1 inhibitor protein 5; inhibitor-5 of protein phosphatase 1; protein phosphatase 1 regulatory subunit 1A
• UniProt Protein Name: Protein phosphatase 1 regulatory subunit 1C
• Protein Family: Protein phosphatase 1 regulatory
• UniProt Gene Name: PPP1R1C
• UniProt Synonym Gene Names: IPP5
• UniProt Entry Name: PPR1C_HUMAN

NCBI Description

Protein phosphatase-1 (PP1) is a major serine/threonine phosphatase that regulates a variety of cellular functions. PP1 consists of a catalytic subunit (see PPP1CA; MIM 176875) and regulatory subunits that determine the subcellular localization of PP1 or regulate its function. PPP1R1C belongs to a group of PP1 inhibitory subunits that are themselves regulated by phosphorylation (Wang et al., 2008 [PubMed 18310074]).[supplied by OMIM, Feb 2010]

Uniprot Description

Function: Inhibitor of protein-phosphatase 1. Promotes cell growth and cell cycle progress at the G1/S transition. May increase cell susceptibility to TNF-induced apoptosis. Ref.4 Ref.5

Subunit structure: Interacts with PPP1CB. Ref.4

Subcellular location: Cytoplasm

By similarity.

Tissue specificity: Expressed in heart, skeletal muscle, liver and testis (at protein level).

Post-translational modification: Phosphorylation of Thr-34 is required for activity.

Sequence similarities: Belongs to the protein phosphatase inhibitor 1 family.