Mouse USP14 Monoclonal Antibody | anti-USP14 antibody

USP14 (Ubiquitin-specific-processing Protease 14, Ubiquitin Carboxyl-terminal Hydrolase 14, Deubiquitinating Enzyme 14, Ubiquitin Thioesterase 14, TGT)

Cat. Num. AAA644528

• Gene Names: USP14; TGT
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: USP14; Monoclonal Antibody; USP14 (Ubiquitin-specific-processing Protease 14; Ubiquitin Carboxyl-terminal Hydrolase 14; Deubiquitinating Enzyme 14; Ubiquitin Thioesterase 14; TGT); Anti -USP14 (Ubiquitin-specific-processing Protease 14; anti-USP14 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6D6
• Specificity: Recognizes human USP14. Species Crossreactivity: mouse and rat.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: PQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ

• Applicable Applications for anti-USP14 antibody: ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in ELISA, Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 20ug/ml
• Immunogen: Partial recombinant corresponding to aa395-495 from USP14 (NP_005142) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to USP14 on HeLa cell. [antibody concentration 20ug/ml])

Testing Data

(Detection limit for recombinant GST tagged USP14 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of USP14 expression in transfected 293T cell line by USP14 monoclonal antibody.|Lane 1: USP14 transfected lysate (56.1kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB)

(USP14 monoclonal antibody Western Blot analysis of USP14 expression in NIH/3T3 .)

Western Blot (WB)

(USP14 monoclonal antibody Western Blot analysis of USP14 expression in PC-12.)

Product Categories/Family for anti-USP14 antibody

Antibodies; Abs to Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 82880645
• NCBI GeneID: 9097
• NCBI Accession #: NP_001032411.1
• NCBI GenBank Nucleotide #: NM_001037334.1
• UniProt Accession #: P54578; Q53XY5; J3QRZ5
• Molecular Weight: 56,069 Da
• NCBI Official Full Name: ubiquitin carboxyl-terminal hydrolase 14 isoform b
• NCBI Official Synonym Full Names: ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
• NCBI Official Symbol: USP14
• NCBI Official Synonym Symbols: TGT
• NCBI Protein Information: ubiquitin carboxyl-terminal hydrolase 14; ubiquitin thioesterase 14; deubiquitinating enzyme 14; ubiquitin thiolesterase 14; ubiquitin-specific processing protease 14; ubiquitin-specific-processing protease 14; tRNA-guanine transglycosylase, 60-kD subunit; ubiquitin specific protease 14 (tRNA-guanine transglycosylase)
• UniProt Protein Name: Ubiquitin carboxyl-terminal hydrolase 14
• UniProt Gene Name: USP14
• UniProt Synonym Gene Names: TGT
• UniProt Entry Name: UBP14_HUMAN

NCBI Description

This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. Mice with a mutation that results in reduced expression of the ortholog of this protein are retarded for growth, develop severe tremors by 2 to 3 weeks of age followed by hindlimb paralysis and death by 6 to 10 weeks of age. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

USP14: Proteasome-associated deubiquitinase which releases ubiquitin from the proteasome targeted ubiquitinated proteins. Ensures the regeneration of ubiquitin at the proteasome. Is a reversibly associated subunit of the proteasome and a large fraction of proteasome-free protein exists within the cell. Required for the degradation of the chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis. Serves also as a physiological inhibitor of endoplasmic reticulum-associated degradation (ERAD) under the non-stressed condition by inhibiting the degradation of unfolded endoplasmic reticulum proteins via interaction with ERN1. Indispensable for synaptic development and function at neuromuscular junctions (NMJs). Homodimer (Potential). Associates with the 26S proteasome. Interacts with FANCC, CXCR4 and ERN1. Belongs to the peptidase C19 family. USP14/UBP6 subfamily.

Protein type: EC 3.4.19.12; Ubiquitin conjugating system; Ubiquitin-specific protease; Protease

Chromosomal Location of Human Ortholog: 18p11.32

Cellular Component: proteasome complex; cell surface; cytoplasm; cytoplasmic membrane-bound vesicle; plasma membrane; synapse; nucleus

Molecular Function: tRNA guanylyltransferase activity; protein binding; cysteine-type endopeptidase activity; endopeptidase inhibitor activity; ubiquitin-specific protease activity

Biological Process: synaptic transmission; proteasomal ubiquitin-dependent protein catabolic process; protein deubiquitination; regulation of chemotaxis