Mouse anti-Human TADA2L Monoclonal Antibody | anti-TADA2A antibody

TADA2L (TADA2A, Transcriptional Adapter 2-alpha, Transcriptional Adapter 2-like, ADA2-like Protein, FLJ12705, KL04P)

Cat. Num. AAA644192

• Gene Names: TADA2A; ADA2; ADA2A; KL04P; hADA2; TADA2L
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: TADA2L; Monoclonal Antibody; TADA2L (TADA2A; Transcriptional Adapter 2-alpha; Transcriptional Adapter 2-like; ADA2-like Protein; FLJ12705; KL04P); Anti -TADA2L (TADA2A; anti-TADA2A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4A8-1A7
• Specificity: Recognizes human TADA2L.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MDRLGSFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHRSDHTYEIMTSDFPVLDPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKYFINNPLFASTLLNLKQAEEAKTADTAIPFHSTDDPPRPTFDSLLSRDMAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQLMERRYPKEVQDLYETMRRFARIVGPVEHDKFIESHACRWFLSLEQYLCVYIYINRRDNGVFYVKFYK

• Applicable Applications for anti-TADA2A antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Full length recombinant corresponding to aa1-306 from human TADA2L (AAH01172) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Related Product Information for anti-TADA2A antibody

Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. Several alternatively spliced transcript variants encoding different isoforms of this gene have been described, but the full-length nature of some of these variants has not been determined.

Product Categories/Family for anti-TADA2A antibody

Antibodies; Abs to Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 260656022
• NCBI GeneID: 6871
• NCBI Accession #: NP_001159577.1
• NCBI GenBank Nucleotide #: NM_001166105.1
• UniProt Accession #: O75478; Q9BVJ0; Q9UCW2; Q9UP49; A8MVD0; B3KMU9
• Molecular Weight: 51,506 Da
• NCBI Official Full Name: transcriptional adapter 2-alpha isoform a
• NCBI Official Synonym Full Names: transcriptional adaptor 2A
• NCBI Official Symbol: TADA2A
• NCBI Official Synonym Symbols: ADA2; ADA2A; KL04P; hADA2; TADA2L
• NCBI Protein Information: transcriptional adapter 2-alpha; ADA2-like protein; transcriptional adaptor 2 alpha
• UniProt Protein Name: Transcriptional adapter 2-alpha
• Protein Family: Transcriptional adapter
• UniProt Gene Name: TADA2A
• UniProt Synonym Gene Names: TADA2L; ADA2-like protein
• UniProt Entry Name: TAD2A_HUMAN

NCBI Description

Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. Several alternatively spliced transcript variants encoding different isoforms of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Oct 2009]

Uniprot Description

TADA2A: Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4. Required for the function of some acidic activation domains, which activate transcription from a distant site. Binds double- stranded DNA. Binds dinucleosomes, probably at the linker region between neighboring nucleosomes. Plays a role in chromatin remodeling. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Acetyltransferase; Transcription, coactivator/corepressor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 17q12-q21

Cellular Component: PCAF complex; chromosome; nucleus

Molecular Function: histone acetyltransferase activity; DNA binding; zinc ion binding; transcription cofactor activity; chromatin binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; establishment and/or maintenance of chromatin architecture; regulation of transcription, DNA-dependent