Mouse anti-Human DNAI1 Polyclonal Antibody | anti-DNAI1 antibody

DNAI1 (Dynein Intermediate Chain 1, Axonemal, Axonemal Dynein Intermediate Chain 1)

Cat. Num. AAA642709

• Gene Names: DNAI1; PCD; DIC1; ICS1; CILD1
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: DNAI1; Polyclonal Antibody; DNAI1 (Dynein Intermediate Chain 1; Axonemal; Axonemal Dynein Intermediate Chain 1); Anti -DNAI1 (Dynein Intermediate Chain 1; anti-DNAI1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human DNAI1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MIPASAKAPHKQPHKQSISIGRGTRKRDEDSGTEVGEGTDEWAQSKATVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQVGNLIPKDSDEGRRQHYRDELVAGSQESVKVISETGNLEEDEEPKELETEPGSQTDVPAAGAAEKVTEEELMTPKQPKERKLTNQFNFSERASQTYNNPVRDRECQTEPPPRTNFSATANQWEIYDAYVEELEKQEKTKEKEKAKTPVAKKSGKMAMRKLTSMESQTDDLIKLSQAAKIMERMVNQNTYDDIAQDFKYYDDAADEYRDQVGTLLPLWKFQNDKAKRLSVTALCWNPKYRDLFAVGYGSYDFMKQSRGMLLLYSLKNPSFPEYMFSSNSGVMCLDIHVDHPYLVAVGHYDGNVAIYNLKKPHSQPSFCSSAKSGKHSDPVWQVKWQKDDMDQNLNFFSVSSDGRIVSWTLVKRKLVHIDVIKLKVEGSTTEVPEGLQLHPVGCGTAFDFHKEIDYMFLVGTEEGKIYKCSKSYSSQFLDTYDAHNMSVDTVSWNPYHTKVFMSCSSDWTVKIWDHTIKTPMFIYDLNSAVGDVAWAPYSSTVFAAVTTDGKAHIFDLAINKYEAICNQPVAAKKNRLTHVQFNLIHPIIIVGDDRGHIISLKLSPNLRKMPKEKKGQEVQKGPAVEIAKLDKLLNLVREVKIKT

• Applicable Applications for anti-DNAI1 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human DNAI1, aa1-699 (NP_036276.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of DNAI1 expression in transfected 293T cell line using MBS642709. Lane 1: DNAI1 transfected lysate (76.89kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-DNAI1 antibody

The inner- and outer-arm dyneins, which bridge between the doublet microtubules in axonemes, are the force-generating proteins responsible for the sliding movement in axonemes. The intermediate and light chains, thought to form the base of the dynein arm, help mediate attachment and may also participate in regulating dynein activity. This gene encodes an intermediate chain dynein, belonging to the large family of motor proteins. Mutations in this gene result in abnormal ciliary ultrastructure and function associated with primary ciliary dyskinesia (PCD) and Kartagener syndrome.

Product Categories/Family for anti-DNAI1 antibody

Antibodies; Abs to Disease Markers

NCBI and Uniprot Product Information

• NCBI GI #: 526479830
• NCBI GeneID: 27019
• NCBI Accession #: NP_001268357.1
• NCBI GenBank Nucleotide #: NM_001281428.1
• UniProt Accession #: Q9UI46; Q5T8G7; Q8NHQ7; Q9UEZ8
• Molecular Weight: 79,283 Da
• NCBI Official Full Name: dynein intermediate chain 1, axonemal isoform 2
• NCBI Official Synonym Full Names: dynein, axonemal, intermediate chain 1
• NCBI Official Symbol: DNAI1
• NCBI Official Synonym Symbols: PCD; DIC1; ICS1; CILD1
• NCBI Protein Information: dynein intermediate chain 1, axonemal; immotile cilia syndrome 1; dynein, axonemal, intermediate polypeptide 1
• UniProt Protein Name: Dynein intermediate chain 1, axonemal
• Protein Family: Dynein
• UniProt Gene Name: DNAI1
• UniProt Entry Name: DNAI1_HUMAN

NCBI Description

This gene encodes a member of the dynein intermediate chain family. The encoded protein is part of the dynein complex in respiratory cilia. The inner- and outer-arm dyneins, which bridge between the doublet microtubules in axonemes, are the force-generating proteins responsible for the sliding movement in axonemes. The intermediate and light chains, thought to form the base of the dynein arm, help mediate attachment and may also participate in regulating dynein activity. Mutations in this gene result in abnormal ciliary ultrastructure and function associated with primary ciliary dyskinesia and Kartagener syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Uniprot Description

DNAI1: Part of the dynein complex of respiratory cilia. Defects in DNAI1 are the cause of primary ciliary dyskinesia type 1 (CILD1). CILD1 is an autosomal recessive disorder characterized by axonemal abnormalities of motile cilia. Respiratory infections leading to chronic inflammation and bronchiectasis are recurrent, due to defects in the respiratory cilia; reduced fertility is often observed in male patients due to abnormalities of sperm tails. Half of the patients exhibit situs inversus, due to dysfunction of monocilia at the embryonic node and randomization of left-right body asymmetry. Primary ciliary dyskinesia associated with situs inversus is referred to as Kartagener syndrome. Defects in DNAI1 are the cause of Kartagener syndrome (KTGS). KTGS is an autosomal recessive disorder characterized by the association of primary ciliary dyskinesia with situs inversus. Clinical features include recurrent respiratory infections, bronchiectasis, infertility, and lateral transposition of the viscera of the thorax and abdomen. The situs inversus is most often total, although it can be partial in some cases (isolated dextrocardia or isolated transposition of abdominal viscera). Belongs to the dynein intermediate chain family.

Protein type: Cytoskeletal; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 9p13.3

Cellular Component: dynein complex; microtubule; cytoskeleton; cytoplasm; cilium

Molecular Function: protein binding; motor activity

Biological Process: cell projection organization and biogenesis; metabolic process

Disease: Ciliary Dyskinesia, Primary, 1