Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged POLR3D is ~0.3ng/ml as a capture antibody.)

Mouse anti-Human POLR3D Monoclonal Antibody | anti-POLR3D antibody

POLR3D (DNA-directed RNA Polymerase III Subunit RPC4, RNA Polymerase III Subunit C4, DNA-directed RNA Polymerase III Subunit D, Protein BN51, RNA Polymerase III 47 kDa Subunit, RPC53 Homolog, BN51, BN51T)

Gene Names
POLR3D; RPC4; BN51T; RPC53; TSBN51
Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
POLR3D; Monoclonal Antibody; POLR3D (DNA-directed RNA Polymerase III Subunit RPC4; RNA Polymerase III Subunit C4; DNA-directed RNA Polymerase III Subunit D; Protein BN51; RNA Polymerase III 47 kDa Subunit; RPC53 Homolog; BN51; BN51T); Anti -POLR3D (DNA-directed RNA Polymerase III Subunit RPC4; anti-POLR3D antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4E6
Specificity
Recognizes human POLR3D.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
GQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDH
Applicable Applications for anti-POLR3D antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa296-395 from human POLR3D with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged POLR3D is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged POLR3D is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-POLR3D antibody
POLR3D is a DNA dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. It plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses and acts as nuclear and cytosolic DNA sensor involved in innate immune response.
Product Categories/Family for anti-POLR3D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
661
UniProt Accession #
Molecular Weight
44,396 Da
NCBI Official Full Name
POLR3D
NCBI Official Synonym Full Names
polymerase (RNA) III (DNA directed) polypeptide D, 44kDa
NCBI Official Symbol
POLR3D
NCBI Official Synonym Symbols
RPC4; BN51T; RPC53; TSBN51
NCBI Protein Information
DNA-directed RNA polymerase III subunit RPC4; RPC53 homolog; RNA polymerase III subunit C4; RNA polymerase III 47 kDa subunit; DNA-directed RNA polymerase III subunit D; BN51 (BHK21) temperature sensitivity complementing; DNA-directed RNA polymerase III 47 kDa polypeptide; temperature sensitive complementation, cell cycle specific, tsBN51
UniProt Protein Name
DNA-directed RNA polymerase III subunit RPC4
UniProt Gene Name
POLR3D
UniProt Synonym Gene Names
BN51; BN51T; RNA polymerase III subunit C4
UniProt Entry Name
RPC4_HUMAN

NCBI Description

This gene complements a temperature-sensitive mutant isolated from the BHK-21 Syrian hamster cell line. It leads to a block in progression through the G1 phase of the cell cycle at nonpermissive temperatures. [provided by RefSeq, Jul 2008]

Uniprot Description

POLR3D: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway. Belongs to the eukaryotic RPC4/POLR3D RNA polymerase subunit family.

Protein type: Nucleotide Metabolism - purine; Nucleotide Metabolism - pyrimidine

Chromosomal Location of Human Ortholog: 8q21

Cellular Component: nucleoplasm; DNA-directed RNA polymerase III complex; nuclear chromatin; cytoplasm; cytosol

Molecular Function: DNA binding; chromatin binding

Biological Process: transcription from RNA polymerase III promoter; termination of RNA polymerase III transcription; positive regulation of innate immune response; positive regulation of interferon-beta production; positive regulation of interferon type I production; innate immune response; gene expression; defense response to virus; RNA elongation from RNA polymerase III promoter

Research Articles on POLR3D

Similar Products

Product Notes

The POLR3D polr3d (Catalog #AAA642617) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The POLR3D (DNA-directed RNA Polymerase III Subunit RPC4, RNA Polymerase III Subunit C4, DNA-directed RNA Polymerase III Subunit D, Protein BN51, RNA Polymerase III 47 kDa Subunit, RPC53 Homolog, BN51, BN51T) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POLR3D can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the POLR3D polr3d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GQVVLIKQEK DREAKLAENA CTLADLTEGQ VGKLLIRKSG RVQLLLGKVT LDVTMGTACS FLQELVSVGL GDSRTGEMTV LGHVKHKLVC SPDFESLLDH. It is sometimes possible for the material contained within the vial of "POLR3D, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.