Western Blot (WB)
(Western Blot analysis of TRIM35 expression in transfected 293T cell line by TRIM35 polyclonal antibody. Lane 1: TRIM35 transfected lysate (56.5kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human TRIM35 Polyclonal Antibody | anti-TRIM35 antibody
TRIM35 (Tripartite Motif Containing 35, Tripartite Motif-containing 35, KIAA1098, Hemopoietic lineage switch protein 5, HLS5) (FITC)
Gene Names
TRIM35; HLS5; MAIR
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TRIM35; Polyclonal Antibody; TRIM35 (Tripartite Motif Containing 35; Tripartite Motif-containing 35; KIAA1098; Hemopoietic lineage switch protein 5; HLS5) (FITC); anti-TRIM35 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TRIM35.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Sequence Length
4227
Applicable Applications for anti-TRIM35 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TRIM35, aa1-493 (NP_741983.2).
Immunogen Sequence
MERSPDVSPGPSRSFKEELLCAVCYDPFRDAVTLRCGHNFCRGCVSRCWEVQVSPTCPVCKDRASPADLRTNHTLNNLVEKLLREEAEGARWTSYRFSRVCRLHRGQLSLFCLEDKELLCCSCQADPRHQGHRVQPVKDTAHDFRAKCRNMEHALREKAKAFWAMRRSYEAIAKHNQVEAAWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKMKQLTEETEVLAHEIERLQMEMKEDDVSFLMKHKSRKRRLFCTMEPEPVQPGMLIDVCKYLGSLQYRVWKKMLASVESVPFSFDPNTAAGWLSVSDDLTSVTNHGYRVQVENPERFSSAPCLLGSRVFSQGSHAWEVALGGLQSWRVGVVRVRQDSGAEGHSHSCYHDTRSGFWYVCRTQGVEGDHCVTSDPATSPLVLAIPRRLRVELECEEGELSFYDAERHCHLYTFHARFGEVRPYFYLGGARGAGPPEPLRICPLHISVKEELDG
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of TRIM35 expression in transfected 293T cell line by TRIM35 polyclonal antibody. Lane 1: TRIM35 transfected lysate (56.5kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of TRIM35 expression in transfected 293T cell line by TRIM35 polyclonal antibody. Lane 1: TRIM35 transfected lysate (56.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-TRIM35 antibody
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified. [provided by RefSeq]
Product Categories/Family for anti-TRIM35 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens tripartite motif containing 35 (TRIM35), mRNA
NCBI Official Synonym Full Names
tripartite motif containing 35
NCBI Official Symbol
TRIM35
NCBI Official Synonym Symbols
HLS5; MAIR
NCBI Protein Information
tripartite motif-containing protein 35
UniProt Protein Name
Tripartite motif-containing protein 35
Protein Family
UniProt Gene Name
TRIM35
UniProt Synonym Gene Names
HLS5; KIAA1098
NCBI Description
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified. [provided by RefSeq, Jul 2008]
Uniprot Description
TRIM35: May play a role as a tumor suppressor. Implicated in the cell death mechanism. Belongs to the TRIM/RBCC family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Ubiquitin conjugating system
Chromosomal Location of Human Ortholog: 8p21.2
Cellular Component: cytoplasm; nucleus
Biological Process: apoptosis; innate immune response; negative regulation of mitotic cell cycle; positive regulation of apoptosis
Research Articles on TRIM35
Similar Products
Product Notes
The TRIM35 trim35 (Catalog #AAA6397229) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM35 (Tripartite Motif Containing 35, Tripartite Motif-containing 35, KIAA1098, Hemopoietic lineage switch protein 5, HLS5) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM35 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRIM35 trim35 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRIM35, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
