Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TOMM34 rabbit polyclonal antibody. Western Blot analysis of TOMM34 expression in mouse testis.)

Rabbit anti-Human, Mouse TOMM34 Polyclonal Antibody | anti-TOMM34 antibody

TOMM34 (Translocase of Outer Membrane 34kD Subunit, Mitochondrial Import Receptor Subunit TOM34, hTom34, HTOM34P, URCC3) APC

Gene Names
TOMM34; TOM34; URCC3; HTOM34P
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TOMM34; Polyclonal Antibody; TOMM34 (Translocase of Outer Membrane 34kD Subunit; Mitochondrial Import Receptor Subunit TOM34; hTom34; HTOM34P; URCC3) APC; anti-TOMM34 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TOMM34. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-TOMM34 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TOMM34, aa1-309 (NP_006800.2).
Immunogen Sequence
MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TOMM34 rabbit polyclonal antibody. Western Blot analysis of TOMM34 expression in mouse testis.)

Western Blot (WB) (TOMM34 rabbit polyclonal antibody. Western Blot analysis of TOMM34 expression in mouse testis.)

Western Blot (WB)

(TOMM34 rabbit polyclonal antibody. Western Blot analysis of TOMM34 expression in Hela NE.)

Western Blot (WB) (TOMM34 rabbit polyclonal antibody. Western Blot analysis of TOMM34 expression in Hela NE.)

Western Blot (WB)

(Western Blot analysis of TOMM34 expression in transfected 293T cell line by TOMM34 polyclonal antibody. Lane 1: TOMM34 transfected lysate (34.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TOMM34 expression in transfected 293T cell line by TOMM34 polyclonal antibody. Lane 1: TOMM34 transfected lysate (34.6kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-TOMM34 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,559 Da
NCBI Official Full Name
mitochondrial import receptor subunit TOM34
NCBI Official Synonym Full Names
translocase of outer mitochondrial membrane 34
NCBI Official Symbol
TOMM34
NCBI Official Synonym Symbols
TOM34; URCC3; HTOM34P
NCBI Protein Information
mitochondrial import receptor subunit TOM34; hTom34; outer mitochondrial membrane translocase (34kD); translocase of outer membrane 34 kDa subunit
UniProt Protein Name
Mitochondrial import receptor subunit TOM34
UniProt Gene Name
TOMM34
UniProt Synonym Gene Names
URCC3; hTom34
UniProt Entry Name
TOM34_HUMAN

NCBI Description

The protein encoded by this gene is involved in the import of precursor proteins into mitochondria. The encoded protein has a chaperone-like activity, binding the mature portion of unfolded proteins and aiding their import into mitochondria. This protein, which is found in the cytoplasm and sometimes associated with the outer mitochondrial membrane, has a weak ATPase activity and contains 6 TPR repeats. [provided by RefSeq, Jul 2008]

Uniprot Description

TOMM34: Plays a role in the import of cytosolically synthesized preproteins into mitochondria. Binds the mature portion of precursor proteins. Interacts with cellular components, and possesses weak ATPase activity. May be a chaperone-like protein that helps to keep newly synthesized precursors in an unfolded import compatible state. Belongs to the Tom34 family.

Protein type: Chaperone; Mitochondrial

Chromosomal Location of Human Ortholog: -

Cellular Component: nucleoplasm; mitochondrial outer membrane; membrane; cytoplasm; integral to membrane; nucleus

Molecular Function: heat shock protein binding

Biological Process: protein targeting to mitochondrion

Research Articles on TOMM34

Similar Products

Product Notes

The TOMM34 tomm34 (Catalog #AAA6396908) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TOMM34 (Translocase of Outer Membrane 34kD Subunit, Mitochondrial Import Receptor Subunit TOM34, hTom34, HTOM34P, URCC3) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TOMM34 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TOMM34 tomm34 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TOMM34, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.