Rabbit anti-Human TAF8 Polyclonal Antibody | anti-TAF8 antibody

TAF8 (Transcription Initiation Factor TFIID Subunit 8, TBP-associated Factor 8, Protein Taube Nuss, TBN, TBP-associated Factor 43kD, Transcription Initiation Factor TFIID 43kD Subunit, TAFII-43, TAFII43, hTAFII43) (MaxLight 490)

Cat. Num. AAA6395967

• Gene Names: TAF8; II; TAF; TBN; TAFII43; TAFII-43
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TAF8; Polyclonal Antibody; TAF8 (Transcription Initiation Factor TFIID Subunit 8; TBP-associated Factor 8; Protein Taube Nuss; TBN; TBP-associated Factor 43kD; Transcription Initiation Factor TFIID 43kD Subunit; TAFII-43; TAFII43; hTAFII43) (MaxLight 490); 43; II; TAF; anti-TAF8 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human TAF8.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

• Applicable Applications for anti-TAF8 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human TAF8, aa1-174 (AAH33728.1).
• Immunogen Sequence: MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPVSDEALGLRVV
• Conjugate: MaxLight490
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-TAF8 antibody

MaxLight490 is a new Blue-Green photostable dye conjugate comparable to DyLight488, Alexa Fluor488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.

Product Categories/Family for anti-TAF8 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 21707438
• NCBI GeneID: 129685
• Molecular Weight: 37,411 Da
• NCBI Official Full Name: Homo sapiens TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa, mRNA
• NCBI Official Synonym Full Names: TATA-box binding protein associated factor 8
• NCBI Official Symbol: TAF8
• NCBI Official Synonym Symbols: II; TAF; TBN; TAFII43; TAFII-43
• NCBI Protein Information: transcription initiation factor TFIID subunit 8
• Protein Family: Transcription initiation factor

NCBI Description

This gene encodes one of several TATA-binding protein (TBP)-associated factors (TAFs), which are integral subunits of the general transcription factor complex TFIID. TFIID recognizes the core promoter of many genes and nucleates the assembly of a transcription preinitiation complex containing RNA polymerase II and other initiation factors. The protein encoded by this gene contains an H4-like histone fold domain, and interacts with several subunits of TFIID including TBP and the histone-fold protein TAF10. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]