Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SERPINF1 expression in transfected 293T cell line by SERPINF1 polyclonal antibody. Lane 1: SERPINF1 transfected lysate (46.3kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human SERPINF1 Polyclonal Antibody | anti-SERPINF1 antibody

SERPINF1 (Pigment Epithelium-derived Factor, PEDF, Serpin-F1, EPC-1, Cell Proliferation-inducing Gene 35 Protein, PEDF, PIG35) (PE)

Gene Names
SERPINF1; OI6; OI12; PEDF; EPC-1; PIG35
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SERPINF1; Polyclonal Antibody; SERPINF1 (Pigment Epithelium-derived Factor; PEDF; Serpin-F1; EPC-1; Cell Proliferation-inducing Gene 35 Protein; PIG35) (PE); anti-SERPINF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SERPINF1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SERPINF1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SERPINF1, aa1-418 (NP_002606.3).
Immunogen Sequence
MQALVLLLCIGALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SERPINF1 expression in transfected 293T cell line by SERPINF1 polyclonal antibody. Lane 1: SERPINF1 transfected lysate (46.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SERPINF1 expression in transfected 293T cell line by SERPINF1 polyclonal antibody. Lane 1: SERPINF1 transfected lysate (46.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SERPINF1 antibody
SERPINF1 is a member of the serpin family. Serpins are a group of serine protease inhibitors, some of which have also been reported to exhibit neurotrophic activity.
Product Categories/Family for anti-SERPINF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,312 Da
NCBI Official Full Name
pigment epithelium-derived factor
NCBI Official Synonym Full Names
serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1
NCBI Official Symbol
SERPINF1
NCBI Official Synonym Symbols
OI6; OI12; PEDF; EPC-1; PIG35
NCBI Protein Information
pigment epithelium-derived factor; serpin F1; cell proliferation-inducing gene 35 protein; serine (or cysteine) proteinase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1
UniProt Protein Name
Pigment epithelium-derived factor
UniProt Gene Name
SERPINF1
UniProt Synonym Gene Names
PEDF; PEDF
UniProt Entry Name
PEDF_HUMAN

NCBI Description

The protein encoded by this gene is a member of the serpin family, although it does not display the serine protease inhibitory activity shown by many of the other serpin family members. The encoded protein is secreted and strongly inhibits angiogenesis. In addition, this protein is a neurotrophic factor involved in neuronal differentiation in retinoblastoma cells.[provided by RefSeq, Mar 2011]

Uniprot Description

PEDF: a secreted neurotrophic protein that induces extensive neuronal differentiation in retinoblastoma cells. Potent inhibitor of angiogenesis. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity. The N-terminal (AA 44-121) exhibits neurite outgrowth-inducing activity. The C-terminal exposed loop (AA 382-418) is essential for serpin activity. Extracellular phosphorylation enhances antiangiogenic activity.

Protein type: Inhibitor; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 17p13.3

Cellular Component: axon hillock; extracellular matrix; extracellular space; perinuclear region of cytoplasm; extracellular region; melanosome; basement membrane

Molecular Function: serine-type endopeptidase inhibitor activity

Biological Process: cell proliferation; positive regulation of neurogenesis; negative regulation of angiogenesis; ovulation cycle; retina development in camera-type eye; short-term memory; response to arsenic; negative regulation of inflammatory response; multicellular organismal development; response to acidity; kidney development; aging

Disease: Osteogenesis Imperfecta, Type Vi

Research Articles on SERPINF1

Similar Products

Product Notes

The SERPINF1 serpinf1 (Catalog #AAA6393826) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SERPINF1 (Pigment Epithelium-derived Factor, PEDF, Serpin-F1, EPC-1, Cell Proliferation-inducing Gene 35 Protein, PEDF, PIG35) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SERPINF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SERPINF1 serpinf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SERPINF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.