Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of RHOC expression in transfected 293T cell line by RHOC polyclonal antibody. Lane 1: RHOC transfected lysate (22kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human RHOC Polyclonal Antibody | anti-RHOC antibody

RHOC (Rho-related GTP-binding Protein RhoC, Rho cDNA Clone 9, h9, ARH9, ARHC) (PE)

Gene Names
RHOC; H9; ARH9; ARHC; RHOH9
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RHOC; Polyclonal Antibody; RHOC (Rho-related GTP-binding Protein RhoC; Rho cDNA Clone 9; h9; ARH9; ARHC) (PE); anti-RHOC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RHOC.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-RHOC antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human RHOC, aa1-193 (NP_786886.1).
Immunogen Sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RHOC expression in transfected 293T cell line by RHOC polyclonal antibody. Lane 1: RHOC transfected lysate (22kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RHOC expression in transfected 293T cell line by RHOC polyclonal antibody. Lane 1: RHOC transfected lysate (22kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-RHOC antibody
This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq]
Product Categories/Family for anti-RHOC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
389
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22,006 Da
NCBI Official Full Name
Homo sapiens ras homolog family member C (RHOC), transcript variant 1, mRNA
NCBI Official Synonym Full Names
ras homolog family member C
NCBI Official Symbol
RHOC
NCBI Official Synonym Symbols
H9; ARH9; ARHC; RHOH9
NCBI Protein Information
rho-related GTP-binding protein RhoC; RAS-related homolog 9; oncogene RHO H9; ras homolog gene family, member C; rho cDNA clone 9; rhoC GTPase; small GTP binding protein RhoC

NCBI Description

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]

Research Articles on RHOC

Similar Products

Product Notes

The RHOC (Catalog #AAA6392539) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RHOC (Rho-related GTP-binding Protein RhoC, Rho cDNA Clone 9, h9, ARH9, ARHC) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RHOC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RHOC for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RHOC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.