Rabbit anti-Human RHOC Polyclonal Antibody | anti-RHOC antibody

RHOC (Rho-related GTP-binding Protein RhoC, Rho cDNA Clone 9, h9, ARH9, ARHC) (PE)

Cat. Num. AAA6392539

• Gene Names: RHOC; H9; ARH9; ARHC; RHOH9
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RHOC; Polyclonal Antibody; RHOC (Rho-related GTP-binding Protein RhoC; Rho cDNA Clone 9; h9; ARH9; ARHC) (PE); anti-RHOC antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human RHOC.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-RHOC antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human RHOC, aa1-193 (NP_786886.1).
• Immunogen Sequence: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RHOC expression in transfected 293T cell line by RHOC polyclonal antibody. Lane 1: RHOC transfected lysate (22kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-RHOC antibody

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq]

Product Categories/Family for anti-RHOC antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 111494249
• NCBI GeneID: 389
• NCBI Accession #: NP_786886.1
• NCBI GenBank Nucleotide #: NM_175744
• Molecular Weight: 22,006 Da
• NCBI Official Full Name: Homo sapiens ras homolog family member C (RHOC), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: ras homolog family member C
• NCBI Official Symbol: RHOC
• NCBI Official Synonym Symbols: H9; ARH9; ARHC; RHOH9
• NCBI Protein Information: rho-related GTP-binding protein RhoC; RAS-related homolog 9; oncogene RHO H9; ras homolog gene family, member C; rho cDNA clone 9; rhoC GTPase; small GTP binding protein RhoC
• Protein Family: Rho-related GTP-binding protein

NCBI Description

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]