Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human PTGER2 Polyclonal Antibody | anti-PTGER2 antibody

PTGER2 (Prostanoid EP2 Receptor, Prostaglandin E2 Receptor EP2 Subtype, PGE2 Receptor EP2 Subtype, PGE Receptor EP2 Subtype) (MaxLight 550)

Gene Names
PTGER2; EP2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PTGER2; Polyclonal Antibody; PTGER2 (Prostanoid EP2 Receptor; Prostaglandin E2 Receptor EP2 Subtype; PGE2 Receptor EP2 Subtype; PGE Receptor EP2 Subtype) (MaxLight 550); anti-PTGER2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PTGER2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-PTGER2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PTGER2, aa1-358 (NP_000947.2).
Immunogen Sequence
MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGRRSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFSLATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQYCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGSGRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQALRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
Conjugate
MaxLight550
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PTGER2 antibody
Prostaglandin E Receptor EP2 is a member of the Prostanoid Receptor subfamily. Along with several other receptor subtypes (EP1, EP3, and EP4), it mediates the diverse biological effects of Prostaglandin E2 (PGE2). PGE2 has been implicated in numerous processes, including immune response modulation, male erectile function, induction of labor, cervical cancer, control of blood pressure, asthma, and more recently, Alzheimer's Disease.
Product Categories/Family for anti-PTGER2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,761 Da
NCBI Official Full Name
prostaglandin E2 receptor EP2 subtype
NCBI Official Synonym Full Names
prostaglandin E receptor 2 (subtype EP2), 53kDa
NCBI Official Symbol
PTGER2
NCBI Official Synonym Symbols
EP2
NCBI Protein Information
prostaglandin E2 receptor EP2 subtype; prostanoid EP2 receptor; PGE receptor EP2 subtype; PGE2 receptor EP2 subtype
UniProt Protein Name
Prostaglandin E2 receptor EP2 subtype
Protein Family
UniProt Gene Name
PTGER2
UniProt Synonym Gene Names
PGE receptor EP2 subtype
UniProt Entry Name
PE2R2_HUMAN

NCBI Description

This gene encodes a receptor for prostaglandin E2, a metabolite of arachidonic acid which has different biologic activities in a wide range of tissues. Mutations in this gene are associated with aspirin-induced susceptibility to asthma. [provided by RefSeq, Oct 2009]

Uniprot Description

PTGER2: Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. The subsequent raise in intracellular cAMP is responsible for the relaxing effect of this receptor on smooth muscle. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, integral; Receptor, GPCR; GPCR, family 1; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 14q22

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: prostaglandin E receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; response to lipopolysaccharide; G-protein signaling, adenylate cyclase activating pathway; regulation of cell proliferation

Disease: Asthma, Nasal Polyps, And Aspirin Intolerance

Research Articles on PTGER2

Similar Products

Product Notes

The PTGER2 ptger2 (Catalog #AAA6391293) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTGER2 (Prostanoid EP2 Receptor, Prostaglandin E2 Receptor EP2 Subtype, PGE2 Receptor EP2 Subtype, PGE Receptor EP2 Subtype) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PTGER2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PTGER2 ptger2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PTGER2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.