Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human PPIA Polyclonal Antibody | anti-PPIA antibody

PPIA (Peptidyl-prolyl Cis-trans Isomerase A, PPIase A, Cyclophilin A, Cyclosporin A-binding Protein, Rotamase A, CYPA, MGC117158, MGC12404, MGC23397) (MaxLight 750)

Gene Names
PPIA; CYPA; CYPH
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PPIA; Polyclonal Antibody; PPIA (Peptidyl-prolyl Cis-trans Isomerase A; PPIase A; Cyclophilin A; Cyclosporin A-binding Protein; Rotamase A; CYPA; MGC117158; MGC12404; MGC23397) (MaxLight 750); anti-PPIA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PPIA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-PPIA antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PPIA, aa1-165 (NP_066953.1).
Immunogen Sequence
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Conjugate
MaxLight750
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PPIA antibody
PPIA is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions.
Product Categories/Family for anti-PPIA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
165
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase A
NCBI Official Synonym Full Names
peptidylprolyl isomerase A (cyclophilin A)
NCBI Official Symbol
PPIA
NCBI Official Synonym Symbols
CYPA; CYPH
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase A; PPIase A; rotamase A; cyclophilin; T cell cyclophilin; cyclosporin A-binding protein
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase A
UniProt Gene Name
PPIA
UniProt Synonym Gene Names
CYPA; PPIase A
UniProt Entry Name
PPIA_HUMAN

Similar Products

Product Notes

The PPIA ppia (Catalog #AAA6390316) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPIA (Peptidyl-prolyl Cis-trans Isomerase A, PPIase A, Cyclophilin A, Cyclosporin A-binding Protein, Rotamase A, CYPA, MGC117158, MGC12404, MGC23397) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPIA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PPIA ppia for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPIA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.