Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human PAK2 Polyclonal Antibody | anti-PAK2 antibody

PAK2 (Serine/Threonine-protein Kinase PAK 2, Gamma-PAK, PAK65, S6/H4 Kinase, p21-activated Kinase 2, PAK-2, p58) (MaxLight 405)

Gene Names
PAK2; PAK65; PAKgamma
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PAK2; Polyclonal Antibody; PAK2 (Serine/Threonine-protein Kinase PAK 2; Gamma-PAK; PAK65; S6/H4 Kinase; p21-activated Kinase 2; PAK-2; p58) (MaxLight 405); anti-PAK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PAK2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-PAK2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PAK2, aa1-524 (NP_002568.2).
Immunogen Sequence
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
Conjugate
MaxLight405
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PAK2 antibody
The PAK (p21-activated kinase) family of serine/threonine kinases plays an important role in multiple cellular processes, including cytoskeletal reorganization, MAPK signaling, apoptotic signaling, etc. Binding of Rac/cdc42 to the CRIB (or PBD) domain at the N-terminal region of PAK causes autophosphorylation and conformational change of PAK. Phosphorylation of Ser21 of PAK1 or Ser20 of PAK2 regulates its binding with the adaptor protein Nck.
Product Categories/Family for anti-PAK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,043 Da
NCBI Official Full Name
serine/threonine-protein kinase PAK 2
NCBI Official Synonym Full Names
p21 protein (Cdc42/Rac)-activated kinase 2
NCBI Official Symbol
PAK2
NCBI Official Synonym Symbols
PAK65; PAKgamma
NCBI Protein Information
serine/threonine-protein kinase PAK 2; p58; PAK-2; gamma-PAK; S6/H4 kinase; p21-activated kinase 2; p21 (CDKN1A)-activated kinase 2
UniProt Protein Name
Serine/threonine-protein kinase PAK 2
UniProt Gene Name
PAK2
UniProt Synonym Gene Names
PAK-2; p27; p34
UniProt Entry Name
PAK2_HUMAN

NCBI Description

The p21 activated kinases (PAK) are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. The PAK proteins are a family of serine/threonine kinases that serve as targets for the small GTP binding proteins, CDC42 and RAC1, and have been implicated in a wide range of biological activities. The protein encoded by this gene is activated by proteolytic cleavage during caspase-mediated apoptosis, and may play a role in regulating the apoptotic events in the dying cell. [provided by RefSeq, Jul 2008]

Uniprot Description

PAK2: a protein kinase of the STE20 family. Critical effector linking RhoGTPases to cytoskeleton reorganization and nuclear signaling. Activated by proteolytic cleavage during caspase-mediated apoptosis, and may play a role in regulating the apoptotic events in the dying cell.

Protein type: Protein kinase, STE; Kinase, protein; EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); STE group; STE20 family; PAKA subfamily

Chromosomal Location of Human Ortholog: 3q29

Cellular Component: nucleoplasm; perinuclear region of cytoplasm; cytoplasm; plasma membrane; cytosol

Molecular Function: protein serine/threonine kinase activity; identical protein binding; protein binding; protein tyrosine kinase activator activity; protein kinase binding; ATP binding; protein kinase activity; receptor signaling protein serine/threonine kinase activity

Biological Process: axon guidance; viral reproduction; apoptosis; protein amino acid autophosphorylation; signal transduction; protein amino acid phosphorylation; T cell receptor signaling pathway; regulation of defense response to virus by virus; regulation of apoptosis; peptidyl-serine phosphorylation; positive regulation of peptidyl-tyrosine phosphorylation; regulation of growth; T cell costimulation; innate immune response; negative regulation of protein kinase activity; mitotic cell cycle; vascular endothelial growth factor receptor signaling pathway; phosphorylation; negative regulation of apoptosis; cell structure disassembly during apoptosis

Research Articles on PAK2

Similar Products

Product Notes

The PAK2 pak2 (Catalog #AAA6388354) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PAK2 (Serine/Threonine-protein Kinase PAK 2, Gamma-PAK, PAK65, S6/H4 Kinase, p21-activated Kinase 2, PAK-2, p58) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PAK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PAK2 pak2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PAK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.