Rabbit anti-Human, Mouse NPC2 Polyclonal Antibody | anti-NPC2 antibody

NPC2 (Epididymal Secretory Protein E1, Human Epididymis-specific Protein 1, He1, Niemann-Pick Disease Type C2 Protein, HE1) (Biotin)

Cat. Num. AAA6387306

• Gene Names: NPC2; HE1; EDDM1
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NPC2; Polyclonal Antibody; NPC2 (Epididymal Secretory Protein E1; Human Epididymis-specific Protein 1; He1; Niemann-Pick Disease Type C2 Protein; HE1) (Biotin); anti-NPC2 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human NPC2. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 921

• Applicable Applications for anti-NPC2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length human NPC2, aa1-151 (NP_006423.1).
• Immunogen Sequence: MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(NPC2 rabbit polyclonal antibody. Western Blot analysis of NPC2 expression in mouse lung.)

Western Blot (WB)

(Western Blot analysis of NPC2 expression in transfected 293T cell line by NPC2 polyclonal antibody. Lane 1: NPC2 transfected lysate (16.6kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-NPC2 antibody

May be involved in the regulation of the lipid composition of sperm membranes during the maturation in the epididymis.

Product Categories/Family for anti-NPC2 antibody

Antibodies; Disease Markers

NCBI and Uniprot Product Information

• NCBI GI #: 29171756
• NCBI GeneID: 10577
• NCBI Accession #: NM_006432.3
• NCBI GenBank Nucleotide #: NM_006432.3
• UniProt Accession #: P61916
• NCBI Official Full Name: Homo sapiens NPC intracellular cholesterol transporter 2 (NPC2), mRNA
• NCBI Official Synonym Full Names: NPC intracellular cholesterol transporter 2
• NCBI Official Symbol: NPC2
• NCBI Official Synonym Symbols: HE1; EDDM1
• NCBI Protein Information: NPC intracellular cholesterol transporter 2
• UniProt Protein Name: Epididymal secretory protein E1
• Protein Family: Non-specific phospholipase
• UniProt Gene Name: NPC2
• UniProt Synonym Gene Names: HE1; He1
• UniProt Entry Name: NPC2_HUMAN

NCBI Description

This gene encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy. [provided by RefSeq, Jul 2008]