Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human MMP7 Polyclonal Antibody | anti-MMP7 antibody

MMP7 (Matrilysin, Matrin, Matrix Metalloproteinase-7, MMP-7, Pump-1 Protease, Uterine Metalloproteinase, MPSL1, PUMP1) (MaxLight 650)

Gene Names
MMP7; MMP-7; MPSL1; PUMP-1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MMP7; Polyclonal Antibody; MMP7 (Matrilysin; Matrin; Matrix Metalloproteinase-7; MMP-7; Pump-1 Protease; Uterine Metalloproteinase; MPSL1; PUMP1) (MaxLight 650); anti-MMP7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MMP7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-MMP7 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human MMP7, aa1-267 (NP_002414.1).
Immunogen Sequence
MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
Conjugate
MaxLight650
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-MMP7 antibody
Defensins are a large family of broad-spectrum antimicrobial peptides, identified originally in leukocytes of rabbits and humans. The genes encoding alpha human beta and defensins are clustered in a contiguous segment of chromosome 8p23. Defensins are initially synthesized as inactive prodefensins with a signal peptide that is cleaved off by Matrilysin/MMP7 (a tissue metalloproteinase) to generate mature and bioactive defensin peptide. Matrilysin is expressed in Paneth cell granules together with perhaps more than 20 different-defensins (cryptidins). Disruption of the matrilysin gene prevents the normal posttranslational proteolytic activation of intestinal prodefensins. Matrix metalloproteinase-7 (MMP-7) also known as matrilysin and PUMP (EC 3.4.24.23) cleaves a number of substrates including collagen types IV and X, elastin, fibronectin, gelatin, laminin and proteoglycans. MMP-7 is closely related to the stromelysin family members but is encoded by a different gene. MMP-7 is the smallest of all the MMPs consisting of a pro-peptide domain and a catalytic domain. It lacks the hemopexin-like domain common to other members of the MMPs. MMP-7 is secreted as a 28kD proenzyme and can be activated in vitro by organomercurials and trypsin and in vivo by MMP-3 to a 18kD active MMP-7 enzyme. Once activated, MMP-7 can activate pro-MMP-1 and pro-MMP-9 but not pro-MMP-2. MMP-7 is widely expressed having been reported in elevated levels in cycling endometrium as well as in colorectal cancers and adenomas, hepatocellular carcinomas, rectal carcinomas, and approximately 50% of gliomas.
Product Categories/Family for anti-MMP7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,677 Da
NCBI Official Full Name
matrilysin preproprotein
NCBI Official Synonym Full Names
matrix metallopeptidase 7 (matrilysin, uterine)
NCBI Official Symbol
MMP7
NCBI Official Synonym Symbols
MMP-7; MPSL1; PUMP-1
NCBI Protein Information
matrilysin; matrin; pump-1 protease; uterine matrilysin; uterine metalloproteinase; matrix metalloproteinase-7; matrix metalloproteinase 7 (matrilysin, uterine)
UniProt Protein Name
Matrilysin
Protein Family
UniProt Gene Name
MMP7
UniProt Synonym Gene Names
MPSL1; PUMP1; MMP-7
UniProt Entry Name
MMP7_HUMAN

NCBI Description

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal protein domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. [provided by RefSeq, Jul 2008]

Uniprot Description

MMP7: Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase. Belongs to the peptidase M10A family.

Protein type: Secreted; Secreted, signal peptide; Protease; EC 3.4.24.23

Chromosomal Location of Human Ortholog: 11q22.2

Cellular Component: extracellular space; proteinaceous extracellular matrix; extracellular region

Molecular Function: zinc ion binding; metalloendopeptidase activity

Biological Process: response to drug; collagen catabolic process; extracellular matrix disassembly; extracellular matrix organization and biogenesis; defense response to Gram-positive bacterium; antibacterial peptide biosynthetic process; defense response to Gram-negative bacterium; proteolysis; antibacterial peptide secretion; regulation of cell proliferation

Research Articles on MMP7

Similar Products

Product Notes

The MMP7 mmp7 (Catalog #AAA6385695) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MMP7 (Matrilysin, Matrin, Matrix Metalloproteinase-7, MMP-7, Pump-1 Protease, Uterine Metalloproteinase, MPSL1, PUMP1) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MMP7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MMP7 mmp7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MMP7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.