Rabbit anti-Human MMP7 Polyclonal Antibody | anti-MMP7 antibody

MMP7 (Matrilysin, Matrin, Matrix Metalloproteinase-7, MMP-7, Pump-1 Protease, Uterine Metalloproteinase, MPSL1, PUMP1) (AP)

Cat. Num. AAA6385687

• Gene Names: MMP7; MMP-7; MPSL1; PUMP-1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MMP7; Polyclonal Antibody; MMP7 (Matrilysin; Matrin; Matrix Metalloproteinase-7; MMP-7; Pump-1 Protease; Uterine Metalloproteinase; MPSL1; PUMP1) (AP); anti-MMP7 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human MMP7.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-MMP7 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human MMP7, aa1-267 (NP_002414.1).
• Immunogen Sequence: MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
• Conjugate: AP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MMP7 expression in transfected 293T cell line by MMP7 polyclonal antibody. Lane 1: MMP7 transfected lysate (29.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between MMP7 and FASLG. HeLa cells were stained with anti-MMP7 rabbit purified polyclonal 1:1200 and anti-FASLG mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Related Product Information for anti-MMP7 antibody

Defensins are a large family of broad-spectrum antimicrobial peptides, identified originally in leukocytes of rabbits and humans. The genes encoding alpha human beta and defensins are clustered in a contiguous segment of chromosome 8p23. Defensins are initially synthesized as inactive prodefensins with a signal peptide that is cleaved off by Matrilysin/MMP7 (a tissue metalloproteinase) to generate mature and bioactive defensin peptide. Matrilysin is expressed in Paneth cell granules together with perhaps more than 20 different-defensins (cryptidins). Disruption of the matrilysin gene prevents the normal posttranslational proteolytic activation of intestinal prodefensins. Matrix metalloproteinase-7 (MMP-7) also known as matrilysin and PUMP (EC 3.4.24.23) cleaves a number of substrates including collagen types IV and X, elastin, fibronectin, gelatin, laminin and proteoglycans. MMP-7 is closely related to the stromelysin family members but is encoded by a different gene. MMP-7 is the smallest of all the MMPs consisting of a pro-peptide domain and a catalytic domain. It lacks the hemopexin-like domain common to other members of the MMPs. MMP-7 is secreted as a 28kD proenzyme and can be activated in vitro by organomercurials and trypsin and in vivo by MMP-3 to a 18kD active MMP-7 enzyme. Once activated, MMP-7 can activate pro-MMP-1 and pro-MMP-9 but not pro-MMP-2. MMP-7 is widely expressed having been reported in elevated levels in cycling endometrium as well as in colorectal cancers and adenomas, hepatocellular carcinomas, rectal carcinomas, and approximately 50% of gliomas.

Product Categories/Family for anti-MMP7 antibody

Antibodies; Matrix Metalloproteinases

NCBI and Uniprot Product Information

• NCBI GI #: 4505219
• NCBI GeneID: 4316
• NCBI Accession #: NP_002414.1
• NCBI GenBank Nucleotide #: NM_002423
• UniProt Accession #: P09237; Q9BTK9
• Molecular Weight: 29,677 Da
• NCBI Official Full Name: matrilysin preproprotein
• NCBI Official Synonym Full Names: matrix metallopeptidase 7 (matrilysin, uterine)
• NCBI Official Symbol: MMP7
• NCBI Official Synonym Symbols: MMP-7; MPSL1; PUMP-1
• NCBI Protein Information: matrilysin; matrin; pump-1 protease; uterine matrilysin; uterine metalloproteinase; matrix metalloproteinase-7; matrix metalloproteinase 7 (matrilysin, uterine)
• UniProt Protein Name: Matrilysin
• Protein Family: Matrilysin
• UniProt Gene Name: MMP7
• UniProt Synonym Gene Names: MPSL1; PUMP1; MMP-7
• UniProt Entry Name: MMP7_HUMAN

NCBI Description

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal protein domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. [provided by RefSeq, Jul 2008]

Uniprot Description

MMP7: Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase. Belongs to the peptidase M10A family.

Protein type: Secreted; Secreted, signal peptide; Protease; EC 3.4.24.23

Chromosomal Location of Human Ortholog: 11q22.2

Cellular Component: extracellular space; proteinaceous extracellular matrix; extracellular region

Molecular Function: zinc ion binding; metalloendopeptidase activity

Biological Process: response to drug; collagen catabolic process; extracellular matrix disassembly; extracellular matrix organization and biogenesis; defense response to Gram-positive bacterium; antibacterial peptide biosynthetic process; defense response to Gram-negative bacterium; proteolysis; antibacterial peptide secretion; regulation of cell proliferation