Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of JAM2 expression in transfected 293T cell line by JAM2 polyclonal antibody. Lane 1: JAM2 transfected lysate (33.2kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human JAM2 Polyclonal Antibody | anti-JAM2 antibody

JAM2 (Junctional Adhesion Molecule B, JAM-B, Junctional Adhesion Molecule 2, JAM-2, Vascular Endothelial Junction-associated Molecule, VE-JAM, CD322, C21orf43, VEJAM, UNQ219/PRO245) (HRP)

Gene Names
JAM2; JAMB; CD322; JAM-B; VEJAM; PRO245; VE-JAM; C21orf43
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
JAM2; Polyclonal Antibody; JAM2 (Junctional Adhesion Molecule B; JAM-B; Junctional Adhesion Molecule 2; JAM-2; Vascular Endothelial Junction-associated Molecule; VE-JAM; CD322; C21orf43; VEJAM; UNQ219/PRO245) (HRP); anti-JAM2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human JAM2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-JAM2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human JAM2, aa1-298 (NP_067042.1).
Immunogen Sequence
MARRSRHRLLLLLLRYLVVALGYHKAYGFSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNISGIIAAVVVVALVISVCGLGVCYAQRKGYFSKETSFQKSNSSSKATTMSENDFKHTKSFII
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of JAM2 expression in transfected 293T cell line by JAM2 polyclonal antibody. Lane 1: JAM2 transfected lysate (33.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of JAM2 expression in transfected 293T cell line by JAM2 polyclonal antibody. Lane 1: JAM2 transfected lysate (33.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-JAM2 antibody
JAM-2 is a novel junctional adhesion molecule and a member of the immunoglobulin superfamily molecules. The JAM-2 transcript is highly expressed during embryogenesis and is detected in lymph node and Peyer's patches RNA of adult mice. JAM-2 participates interendothelial junctional complexes.
Product Categories/Family for anti-JAM2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,554 Da
NCBI Official Full Name
junctional adhesion molecule B isoform 1
NCBI Official Synonym Full Names
junctional adhesion molecule 2
NCBI Official Symbol
JAM2
NCBI Official Synonym Symbols
JAMB; CD322; JAM-B; VEJAM; PRO245; VE-JAM; C21orf43
NCBI Protein Information
junctional adhesion molecule B; JAM-2; JAM-IT/VE-JAM; vascular endothelial junction-associated molecule
UniProt Protein Name
Junctional adhesion molecule B
UniProt Gene Name
JAM2
UniProt Synonym Gene Names
C21orf43; VEJAM; JAM-B; JAM-2; VE-JAM
UniProt Entry Name
JAM2_HUMAN

NCBI Description

This gene belongs to the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. The protein encoded by this gene is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. It acts as an adhesive ligand for interacting with a variety of immune cell types, and may play a role in lymphocyte homing to secondary lymphoid organs. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2012]

Uniprot Description

JAM2: May play a role in the processes of lymphocyte homing to secondary lymphoid organs. Belongs to the immunoglobulin superfamily.

Protein type: Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 21q21.2

Cellular Component: tight junction; integral to plasma membrane; plasma membrane

Molecular Function: protein binding; protein heterodimerization activity

Biological Process: extracellular matrix organization and biogenesis; cell-cell adhesion; negative regulation of cell adhesion; blood coagulation; leukocyte migration

Research Articles on JAM2

Similar Products

Product Notes

The JAM2 jam2 (Catalog #AAA6383359) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The JAM2 (Junctional Adhesion Molecule B, JAM-B, Junctional Adhesion Molecule 2, JAM-2, Vascular Endothelial Junction-associated Molecule, VE-JAM, CD322, C21orf43, VEJAM, UNQ219/PRO245) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's JAM2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the JAM2 jam2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "JAM2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.