Rabbit anti-Human Interleukin 24 Polyclonal Antibody | anti-IL-24 antibody

Interleukin 24 (Interleukin-24, IL-24, IL24, Melanoma Differentiation-associated Gene 7 Protein, MDA-7, Suppression of Tumorigenicity 16 Protein, MDA7, ST16) (FITC)

Cat. Num. AAA6382995

• Gene Names: IL24; C49A; FISP; MDA7; MOB5; ST16; IL10B
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Interleukin 24; Polyclonal Antibody; Interleukin 24 (Interleukin-24; IL-24; IL24; Melanoma Differentiation-associated Gene 7 Protein; MDA-7; Suppression of Tumorigenicity 16 Protein; MDA7; ST16) (FITC); anti-IL-24 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human IL24.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).

• Applicable Applications for anti-IL-24 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human IL24, aa1-206 (NP_006841.1).
• Immunogen Sequence: MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of IL24 expression in transfected 293T cell line by IL24 polyclonal antibody. Lane 1: IL24 transfected lysate (23.8kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-IL-24 antibody

Interleukin 24 (IL-24), also known as mda-7 (melanoma differentiation associated gene-7), is a newly discovered member of the IL-10 family of helical cytokines. The IL-24 gene encodes a precursor protein of 207 amino acids (aa) that contains a 48 aa signal sequence and an 18kD, 158 aa mature segment. There are three potential N-linked glycosylation sites, at least one of which is used. When secreted, IL-24 is a 35-40kD phosphorylated glycoprotein that apparently can exist as either a monomer or dimer. It is suggested that glycosylation is essential for activity. Mature human IL-24 shares 69% aa sequence identity with mouse and rat IL-24. Human IL-24 is active in rodent systems. Cells known to express IL-24 include B cells, CD4+ T cells, NK cells, lymph node dendritic cells, monocytes, melanocytes, and melanoma cells. Functionally, IL-24 has diverse activities. At low concentrations on monocytes, it induces type I proinflammatory cytokines such as IFN-gamma, IL-1Beta, IL-12 and TNF-alpha. At high concentrations, it is a strong inducer of apoptosis in tumor cells, but not in normal cells. IL-24 also has anti-angiogenic properties. It binds directly to IL-24 receptors on endothelial cells, activating STAT3 and blocking their differentiation. IL-24 binds and signals through two heterodimeric receptor complexes. One complex is the combination of IL-20 Ralpha. and IL-20 RBeta, which is shared with IL-19 and IL-20. The second complex is a combination of IL-22 R and IL-20 RBeta, which is shared with IL-20.

Product Categories/Family for anti-IL-24 antibody

Antibodies; Interleukin

NCBI and Uniprot Product Information

• NCBI GI #: 5803086
• NCBI GeneID: 11009
• NCBI Accession #: NP_006841.1
• NCBI GenBank Nucleotide #: NM_006850
• UniProt Accession #: Q13007; Q2YHE5; Q53XZ7; Q5YLN8; Q96DB0; Q96KG4
• Molecular Weight: 7,347 Da
• NCBI Official Full Name: interleukin-24 isoform 1
• NCBI Official Synonym Full Names: interleukin 24
• NCBI Official Symbol: IL24
• NCBI Official Synonym Symbols: C49A; FISP; MDA7; MOB5; ST16; IL10B
• NCBI Protein Information: interleukin-24; melanocyte-associated Mda-7; IL-4-induced secreted protein; melanoma differentiation-associated gene 7 protein; suppression of tumorigenicity 16 (melanoma differentiation)
• UniProt Protein Name: Interleukin-24
• UniProt Gene Name: IL24
• UniProt Synonym Gene Names: MDA7; ST16; IL-24; MDA-7
• UniProt Entry Name: IL24_HUMAN

NCBI Description

This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38), and heat shock 27kDa protein 1 (HSPB2/HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

IL24: Has antiproliferative properties on melanoma cells and may contribute to terminal cell differentiation. Belongs to the IL-10 family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: extracellular space; endoplasmic reticulum

Molecular Function: cytokine activity

Biological Process: negative regulation of cell proliferation; wound healing; apoptosis; positive regulation of cell proliferation; positive regulation of JAK-STAT cascade; positive regulation of caspase activity; immune response; negative regulation of caspase activity; inflammatory response; negative regulation of cell migration; positive regulation of tyrosine phosphorylation of Stat3 protein; serine phosphorylation of STAT3 protein