Rabbit anti-Human MDA5 Polyclonal Antibody | anti-MDA5 antibody

MDA5 (Melanoma Differentiation-associated Protein 5, MDA-5, Interferon-induced Helicase C Domain-containing Protein 1, Clinically Amyopathic Dermatomyositis Autoantigen 140kD, CADM-140 Autoantigen, Helicase with 2 CARD Domains, Helicard, Hlcd, IDDM19, Int

Cat. Num. AAA6382133

• Gene Names: IFIH1; AGS7; Hlcd; MDA5; MDA-5; RLR-2; IDDM19; SGMRT1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MDA5; Polyclonal Antibody; MDA5 (Melanoma Differentiation-associated Protein 5; MDA-5; Interferon-induced Helicase C Domain-containing Protein 1; Clinically Amyopathic Dermatomyositis Autoantigen 140kD; CADM-140 Autoantigen; Helicase with 2 CARD Domains; Helicard; Hlcd; IDDM19; Int; anti-MDA5 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human IFIH1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 1630

• Applicable Applications for anti-MDA5 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human IFIH1, aa1-221 (AAH46208.1).
• Immunogen Sequence: MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSESNAGICNFTEEDSSNSA
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of IFIH1 expression in transfected 293T cell line by IFIH1 polyclonal antibody. Lane 1: IFIH1 transfected lysate (25.1kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-MDA5 antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 28279330
• NCBI GeneID: 64135
• NCBI Official Full Name: Homo sapiens interferon induced with helicase C domain 1, mRNA
• NCBI Official Synonym Full Names: interferon induced with helicase C domain 1
• NCBI Official Symbol: IFIH1
• NCBI Official Synonym Symbols: AGS7; Hlcd; MDA5; MDA-5; RLR-2; IDDM19; SGMRT1
• NCBI Protein Information: interferon-induced helicase C domain-containing protein 1

NCBI Description

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein that is upregulated in response to treatment with beta-interferon and a protein kinase C-activating compound, mezerein. Irreversible reprogramming of melanomas can be achieved by treatment with both these agents; treatment with either agent alone only achieves reversible differentiation. Genetic variation in this gene is associated with diabetes mellitus insulin-dependent type 19. [provided by RefSeq, Jul 2012]