Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of HOXB7 expression in transfected 293T cell line by HOXB7 polyclonal antibody. Lane 1: HOXB7 transfected lysate (24kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human HOXB7 Polyclonal Antibody | anti-HOXB7 antibody

HOXB7 (HOX2C, Homeobox Protein Hox-B7, Homeobox Protein HHO.C1, Homeobox Protein Hox-2C) APC

Gene Names
HOXB7; HOX2; HOX2C; HHO.C1; Hox-2.3
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HOXB7; Polyclonal Antibody; HOXB7 (HOX2C; Homeobox Protein Hox-B7; Homeobox Protein HHO.C1; Homeobox Protein Hox-2C) APC; anti-HOXB7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HOXB7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
837
Applicable Applications for anti-HOXB7 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length human HOXB7, aa1-217 (AAH15345.1).
Immunogen Sequence
MSSLYYANALFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HOXB7 expression in transfected 293T cell line by HOXB7 polyclonal antibody. Lane 1: HOXB7 transfected lysate (24kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HOXB7 expression in transfected 293T cell line by HOXB7 polyclonal antibody. Lane 1: HOXB7 transfected lysate (24kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified rabbit antibody to HOXB7 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of purified rabbit antibody to HOXB7 on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-HOXB7 antibody
References
1. MicroRNA miR-196a is a central regulator of HOX-B7 and BMP4 expression in malignant melanoma. Braig S, Mueller DW, Rothhammer T, Bosserhoff AK.Cell Mol Life Sci. 2010 May 18.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens homeobox B7, mRNA
NCBI Official Synonym Full Names
homeobox B7
NCBI Official Symbol
HOXB7
NCBI Official Synonym Symbols
HOX2; HOX2C; HHO.C1; Hox-2.3
NCBI Protein Information
homeobox protein Hox-B7
Protein Family

NCBI Description

This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma. [provided by RefSeq, Jul 2008]

Research Articles on HOXB7

Similar Products

Product Notes

The HOXB7 (Catalog #AAA6381563) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HOXB7 (HOX2C, Homeobox Protein Hox-B7, Homeobox Protein HHO.C1, Homeobox Protein Hox-2C) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HOXB7 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HOXB7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HOXB7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.