Rabbit anti-Human DUT Polyclonal Antibody | anti-DUT antibody

DUT (Deoxyuridine 5'-triphosphate Nucleotidohydrolase, Mitochondrial, dUTPase, dUTP Pyrophosphatase) (PE)

Cat. Num. AAA6376765

• Gene Names: DUT; dUTPase
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DUT; Polyclonal Antibody; DUT (Deoxyuridine 5'-triphosphate Nucleotidohydrolase; Mitochondrial; dUTPase; dUTP Pyrophosphatase) (PE); anti-DUT antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human DUT.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-DUT antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human DUT, aa1-252 (NP_001020419.1).
• Immunogen Sequence: MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of DUT expression in transfected 293T cell line by DUT polyclonal antibody. Lane 1: DUT transfected lysate (26.6kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-DUT antibody

Deoxyuridine triphosphate nucleotidohydrolase (dUTPase) is a ubiquitous enzyme that functions in the hydrolysis of dUTP to dUMP and pyrophosphate. Canman and co-workers have demonstrated that, in certain human tumor cell lines, increased levels of dUTPase are responsible for an increase in resistance to the cancer chemotherapeutic agent fluorodeoxyuridine (FUdR), a thymidine synthase inhibitor. Two distinct forms of dUTPase exist in humans. Cellular fractionation experiments suggest that the more abundant, lower mass form of dUTPase (DUT-N) localizes in the nucleus, while the higher mass form (DUT-M) is associated with the mitochondria.

Product Categories/Family for anti-DUT antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 70906441
• NCBI GeneID: 1854
• NCBI Accession #: NP_001020419.1
• NCBI GenBank Nucleotide #: NM_001025248
• UniProt Accession #: P33316; O14785; Q16708; Q16860; Q6FHN1; Q6NSA3; Q96Q81; A8K650; B4DPR5
• Molecular Weight: 17,748 Da
• NCBI Official Full Name: deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial isoform 1
• NCBI Official Synonym Full Names: deoxyuridine triphosphatase
• NCBI Official Symbol: DUT
• NCBI Official Synonym Symbols: dUTPase
• NCBI Protein Information: deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial; dUTP nucleotidohydrolase; dUTP pyrophosphatase
• UniProt Protein Name: Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
• Protein Family: Deoxyuridine 5'-triphosphate nucleotidohydrolase
• UniProt Gene Name: DUT
• UniProt Synonym Gene Names: dUTPase
• UniProt Entry Name: DUT_HUMAN

NCBI Description

This gene encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19. [provided by RefSeq, Jul 2008]

Uniprot Description

dUTPase: This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA. Belongs to the dUTPase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; Motility/polarity/chemotaxis; Mitochondrial; DNA replication; Nuclear receptor co-regulator; Nucleotide Metabolism - pyrimidine; EC 3.6.1.23

Chromosomal Location of Human Ortholog: 15q21.1

Cellular Component: nucleoplasm; mitochondrion; nucleus

Molecular Function: protein binding; magnesium ion binding; dUTP diphosphatase activity

Biological Process: dUTP catabolic process; pyrimidine base metabolic process; nucleobase, nucleoside and nucleotide metabolic process; pyrimidine nucleoside biosynthetic process; nucleobase, nucleoside, nucleotide and nucleic acid metabolic process; DNA replication; dUMP biosynthetic process