Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (DLX1 rabbit polyclonal antibody. Western Blot analysis of DLX1 expression in human liver.)

Rabbit anti-Human DLX1 Polyclonal Antibody | anti-DLX1 antibody

DLX1 (Distal-less Homeobox 1, DLX 1, DLX-1, Homeobox Protein DLX1, OTTMUSP00000014202) (AP)

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DLX1; Polyclonal Antibody; DLX1 (Distal-less Homeobox 1; DLX 1; DLX-1; Homeobox Protein DLX1; OTTMUSP00000014202) (AP); anti-DLX1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DLX1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
255
Applicable Applications for anti-DLX1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human DLX1, aa1-255 (NP_835221.2).
Immunogen Sequence
MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSASSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQLM
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(DLX1 rabbit polyclonal antibody. Western Blot analysis of DLX1 expression in human liver.)

Western Blot (WB) (DLX1 rabbit polyclonal antibody. Western Blot analysis of DLX1 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of DLX1 expression in transfected 293T cell line by DLX1 polyclonal antibody. Lane 1: DLX1 transfected lysate (27.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DLX1 expression in transfected 293T cell line by DLX1 polyclonal antibody. Lane 1: DLX1 transfected lysate (27.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-DLX1 antibody
This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. The encoded protein may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain. This gene is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 2. Alternatively spliced transcript variants encoding different isoforms have been described.
Product Categories/Family for anti-DLX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
homeobox protein DLX-1 isoform 1
NCBI Official Synonym Full Names
distal-less homeobox 1
NCBI Official Symbol
DLX1
NCBI Protein Information
homeobox protein DLX-1
UniProt Protein Name
Homeobox protein DLX-1
Protein Family
UniProt Gene Name
DLX1
UniProt Entry Name
DLX1_HUMAN

NCBI Description

This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. The encoded protein may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain. This gene is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 2. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Research Articles on DLX1

Similar Products

Product Notes

The DLX1 dlx1 (Catalog #AAA6376315) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DLX1 (Distal-less Homeobox 1, DLX 1, DLX-1, Homeobox Protein DLX1, OTTMUSP00000014202) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DLX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DLX1 dlx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DLX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.