Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human CDK5 Polyclonal Antibody | anti-CDK5 antibody

CDK5 (Cyclin-Dependent Kinase 5, Cell Division Protein Kinase 5, Serine/Threonine-protein Kinase PSSALRE, Tau Protein Kinase II Catalytic Subunit, TPKII Catalytic Subunit) (MaxLight 405)

Gene Names
CDK5; PSSALRE
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDK5; Polyclonal Antibody; CDK5 (Cyclin-Dependent Kinase 5; Cell Division Protein Kinase 5; Serine/Threonine-protein Kinase PSSALRE; Tau Protein Kinase II Catalytic Subunit; TPKII Catalytic Subunit) (MaxLight 405); anti-CDK5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CDK5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-CDK5 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CDK5, aa1-292 (NP_004926.1).
Immunogen Sequence
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
Conjugate
MaxLight405
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CDK5 antibody
Cdk5 is ubiquitously expressed, but expression and activity is highest in post mitotic neurones, where p35 and p39 are highly expressed. Deregulation of this kinase is neurotoxic and might contribute to the pathogenesis of Alzheimer's disease and other neurodegenerative disorders.
Product Categories/Family for anti-CDK5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,304 Da
NCBI Official Full Name
cyclin-dependent kinase 5 isoform 1
NCBI Official Synonym Full Names
cyclin-dependent kinase 5
NCBI Official Symbol
CDK5
NCBI Official Synonym Symbols
PSSALRE
NCBI Protein Information
cyclin-dependent kinase 5; TPKII catalytic subunit; protein kinase CDK5 splicing; cell division protein kinase 5; serine/threonine-protein kinase PSSALRE; tau protein kinase II catalytic subunit
UniProt Protein Name
Cyclin-dependent kinase 5
Protein Family
UniProt Gene Name
CDK5
UniProt Synonym Gene Names
CDKN5; TPKII catalytic subunit
UniProt Entry Name
CDK5_HUMAN

NCBI Description

This gene encodes a proline-directed serine/threonine kinase that is a member of the cyclin-dependent kinase family of proteins. Unlike other members of the family, the protein encoded by this gene does not directly control cell cycle regulation. Instead the protein, which is predominantly expressed at high levels in mammalian postmitotic central nervous system neurons, functions in diverse processes such as synaptic plasticity and neuronal migration through phosphorylation of proteins required for cytoskeletal organization, endocytosis and exocytosis, and apoptosis. In humans, an allelic variant of the gene that results in undetectable levels of the protein has been associated with lethal autosomal recessive lissencephaly-7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2015]

Uniprot Description

CDK5: a protein kinase of the CDK family. Unlike other members of this family, it is not activated by cyclins but by p35 (CDK5R1) and p39. An important regulator of neuronal positioning during brain development. May also play a role in synaptogenesis and neurotransmission. Substrates include TAU, MAP2, NF-H and -M, Nudel, PDE6, beta-catenin, amphyphysin, dynamin I, synapsin 1, Munc-18, and NMDA receptor 2A. Plays a role in myogenesis, haematopoietic cell differentiation, spermatogenesis, insulin secretion, and lens differentiation. Implicated in the pathology of neurofibrillary tangles and formation of senile plaques, hallmarks of Alzheimer?s disease. Induces tau phosphorylation and aggregation and neurofibrillary tangle deposition and neurodegeneration in in vitro and in vivo animal models. Brain samples from Alzeimer?s pateints show elevated CDK5 activity.

Protein type: Kinase, protein; EC 2.7.11.1; Cell cycle regulation; Protein kinase, Ser/Thr (non-receptor); Protein kinase, CMGC; CMGC group; CDK family; CDK5 subfamily; CDK/CDK5 subfamily

Chromosomal Location of Human Ortholog: 7q36

Cellular Component: cyclin-dependent protein kinase 5 activator complex; dendrite; postsynaptic density; perikaryon; cytosol; postsynaptic membrane; cytoskeleton; growth cone; membrane; cell soma; axon; lamellipodium; cytoplasm; nucleus; cell junction; neuromuscular junction; filopodium

Molecular Function: acetylcholine receptor activator activity; ephrin receptor binding; p53 binding; protein kinase activity; protein serine/threonine kinase activity; ErbB-2 class receptor binding; protein binding; ErbB-3 class receptor binding; cyclin-dependent protein kinase activity; cytoskeletal protein binding; tau-protein kinase activity; kinase activity; ATP binding

Biological Process: Schwann cell development; negative regulation of synaptic plasticity; axon extension; cerebellar cortex formation; rhythmic process; regulation of synaptic plasticity; motor axon guidance; sensory perception of pain; receptor clustering; regulation of cell migration; corpus callosum development; regulation of apoptosis; neuron differentiation; receptor catabolic process; oligodendrocyte differentiation; neurite development; central nervous system neuron development; synaptic transmission, glutamatergic; skeletal muscle development; dendrite morphogenesis; cell division; synaptic vesicle endocytosis; negative regulation of protein ubiquitination; negative regulation of transcription, DNA-dependent; axon guidance; regulated secretory pathway; synaptic transmission, dopaminergic; negative regulation of protein export from nucleus; positive regulation of protein binding; protein amino acid autophosphorylation; cell-matrix adhesion; neuron migration; nucleocytoplasmic transport; negative regulation of axon extension; negative regulation of cell cycle; synaptic transmission; intracellular protein transport; synaptogenesis; behavioral response to cocaine; positive regulation of neuron apoptosis; visual learning; cortical actin cytoskeleton organization and biogenesis; layer formation in the cerebral cortex; serine phosphorylation of STAT3 protein; negative regulation of proteolysis; hippocampus development; peptidyl-threonine phosphorylation; cell cycle; cell proliferation; positive regulation of calcium ion-dependent exocytosis; embryonic development; synaptic vesicle exocytosis; peptidyl-serine phosphorylation; neuron apoptosis; positive regulation of protein kinase activity; blood coagulation; regulation of excitatory postsynaptic membrane potential; phosphorylation

Disease: Lissencephaly 7 With Cerebellar Hypoplasia

Research Articles on CDK5

Similar Products

Product Notes

The CDK5 cdk5 (Catalog #AAA6373548) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDK5 (Cyclin-Dependent Kinase 5, Cell Division Protein Kinase 5, Serine/Threonine-protein Kinase PSSALRE, Tau Protein Kinase II Catalytic Subunit, TPKII Catalytic Subunit) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDK5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDK5 cdk5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDK5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.