Western Blot (WB)
(CDC14B rabbit polyclonal antibody. Western Blot analysis of CDC14B expression in human liver.)
Rabbit anti-Human CDC14B Polyclonal Antibody | anti-CDC14B antibody
CDC14B (Dual Specificity Protein Phosphatase CDC14B, CDC14 Cell Division Cycle 14 Homolog B, Cdc14B1, Cdc14B2, CDC14B3, hCDC14B) (Biotin)
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDC14B; Polyclonal Antibody; CDC14B (Dual Specificity Protein Phosphatase CDC14B; CDC14 Cell Division Cycle 14 Homolog B; Cdc14B1; Cdc14B2; CDC14B3; hCDC14B) (Biotin); anti-CDC14B antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CDC14B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CDC14B antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CDC14B, aa1-471.
Immunogen Sequence
MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASNVHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFADGSTPTDAIVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIGPQQQFLVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQSKTNAIPLTDGWLSQAVTFLDRLLIWLGIHKD
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(CDC14B rabbit polyclonal antibody. Western Blot analysis of CDC14B expression in human liver.)
Western Blot (WB)
(CDC14B rabbit polyclonal antibody. Western Blot analysis of CDC14B expression in human liver.)
Western Blot (WB)
(Western Blot analysis of CDC14B expression in transfected 293T cell line by CDC14B polyclonal antibody. Lane 1: CDC14B transfected lysate (54.2kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of CDC14B expression in transfected 293T cell line by CDC14B polyclonal antibody. Lane 1: CDC14B transfected lysate (54.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CDC14B antibody
CDC14B is a member of the dual specificity protein tyrosine phosphatase family. This protein is highly similar to Saccharomyces cerevisiae Cdc14, a protein tyrosine phosphatase involved in the exit of cell mitosis and initiation of DNA replication, which suggests the role in cell cycle control. This protein has been shown to interact with and dephosphorylates tumor suppressor protein p53, and is thought to regulate the function of p53. Alternative splice of this gene results in 3 transcript variants encoding distinct isoforms.
Product Categories/Family for anti-CDC14B antibody
Similar Products
Product Notes
The CDC14B (Catalog #AAA6373391) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDC14B (Dual Specificity Protein Phosphatase CDC14B, CDC14 Cell Division Cycle 14 Homolog B, Cdc14B1, Cdc14B2, CDC14B3, hCDC14B) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDC14B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDC14B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDC14B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
