Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human AMY2A Polyclonal Antibody | anti-AMY2A antibody

AMY2A (Pancreatic alpha-amylase, PA, 1,4-alpha-D-glucan Glucanohydrolase) (MaxLight 550)

Gene Names
AMY2A; PA; AMY2; AMY2B
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AMY2A; Polyclonal Antibody; AMY2A (Pancreatic alpha-amylase; PA; 1; 4-alpha-D-glucan Glucanohydrolase) (MaxLight 550); anti-AMY2A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human AMY2A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-AMY2A antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human AMY2A, aa1-511 (NP_000690.1).
Immunogen Sequence
MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Conjugate
MaxLight550
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-AMY2A antibody
Pancreatic amylase is a digestive enzyme with a molecular weight of approximately 56kD secreted by the pancreas. Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen.
Product Categories/Family for anti-AMY2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
279
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
160,000
NCBI Official Full Name
pancreatic alpha-amylase
NCBI Official Synonym Full Names
amylase, alpha 2A (pancreatic)
NCBI Official Symbol
AMY2A
NCBI Official Synonym Symbols
PA; AMY2; AMY2B
NCBI Protein Information
pancreatic alpha-amylase; glycogenase; found in the pancreas; pancreatic amylase 2A; pancreatic amylase alpha 2A; amylase, pancreatic, alpha-2A; 1,4-alpha-D-glucan glucanohydrolase
UniProt Protein Name
Pancreatic alpha-amylase
UniProt Gene Name
AMY2A
UniProt Synonym Gene Names
PA
UniProt Entry Name
AMYP_HUMAN

NCBI Description

Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the pancreas. [provided by RefSeq, Jul 2008]

Uniprot Description

AMY2A: Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the pancreas. [provided by RefSeq, Jul 2008]

Protein type: EC 3.2.1.1; Secreted; Hydrolase; Secreted, signal peptide; Carbohydrate Metabolism - starch and sucrose

Chromosomal Location of Human Ortholog: 1p21

Cellular Component: extracellular space; extracellular region

Molecular Function: alpha-amylase activity; calcium ion binding; chloride ion binding

Biological Process: polysaccharide digestion; carbohydrate catabolic process; carbohydrate metabolic process; pathogenesis

Research Articles on AMY2A

Similar Products

Product Notes

The AMY2A amy2a (Catalog #AAA6369788) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AMY2A (Pancreatic alpha-amylase, PA, 1,4-alpha-D-glucan Glucanohydrolase) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AMY2A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AMY2A amy2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AMY2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.