Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Phospholipase A2, Secretory, Group XII Recombinant Protein | Arch_0563 recombinant protein

Phospholipase A2, Secretory, Group XII, Recombinant, Human (PLA2, sPLA2-XII)

Purity
Highly Purified
95% (SDS-PAGE); Ni-NTA affinity chromatography.
Synonyms
Phospholipase A2; Secretory; Group XII; Recombinant; Human (PLA2; sPLA2-XII); Arch_0563 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Specificity
The amino acid sequence of the recombinant human Secreted Phospholipase A2-XII is 100% homologous to the amino acid sequence of the human Secreted Phospholipase A2-XII without signal sequence.
Purity/Purification
Highly Purified
95% (SDS-PAGE); Ni-NTA affinity chromatography.
Form/Format
Supplied as a lyophilized powder in 0.01M Tris buffer, pH 8.6.
Sequence
MRGSHHHHHHGMASHMQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPR YGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHV QACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL
Application Notes
Western blotting
Reconstitution
Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely.
Preparation and Storage
Store lyophilized protein at -20 degree C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 degree C for a limited period of time; it does not show any change after two weeks at 4 degree C.
Related Product Information for Arch_0563 recombinant protein
Phospholipase A2 (PLA2) catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to liberate arachidonic acid (AA), a precursor of eicosanoids including prostaglandins and leukotrienes. The same reaction also produces lysophosholipids, which represent another class of lipid mediators. The secretory PLA2 (sPLA2) family, in which 10 isozymes have been identified, consists of lowmolecular weight, Ca2+-requiring secretory enzymes that have been implicated in a number of biological processes, such as modification of eicosanoid generation, inflammation, and host defense. This enzyme has been proposed to hydrolyze phosphatidylcholine (PC) in lipoproteins to liberate lyso- PC and free fatty acids in the arterial wall, thereby facilitating the accumulation of bioactive lipids and modified lipoproteins in atherosclerotic foci. In mice, sPLA2 expression significantly influences HDL particle size and composition and demonstrate that an induction of sPLA2 is required for the decrease in plasma HDL cholesterol in response to inflammatory stimuli. Instillation of bacteria into the bronchi was associated with surfactant degradation and a decrease in large:small ratio of surfactant aggregates in rats.

Recombinant Human Secreted Phospholipase A2-XII was produced with N-terminal His-Tag, is 20.6kD polypeptide containing 167 amino acid residues of the human secreted phospholipase A2-XII and 16 additional amino acid residues.
Product Categories/Family for Arch_0563 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
20.6kD
NCBI Official Full Name
phospholipase A2
NCBI Official Symbol
Arch_0563
NCBI Protein Information
phospholipase A2

Similar Products

Product Notes

The Arch_0563 (Catalog #AAA636574) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. Western blotting. Researchers should empirically determine the suitability of the Arch_0563 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRGSHHHHHH GMASHMQEQA QTTDWRATLK TIRNGVHKID TYLNAALDLL GGEDGLCQYK CSDGSKPFPR YGYKPSPPNG CGSPLFGVHL NIGIPSLTKC CNQHDRCYET CGKSKNDCDE EFQYCLSKIC RDVQKTLGLT QHV QACETTVELL FDSVIHLGCK PYLDSQRAAC RCHYEEKTDL. It is sometimes possible for the material contained within the vial of "Phospholipase A2, Secretory, Group XII, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.