Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse TRADD Monoclonal Antibody | anti-TRADD antibody

TRADD (TNFRSF1A-Associated via Death Domain, Hs.89862, MGC11078) (MaxLight 750)

Gene Names
TRADD; Hs.89862
Applications
Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
TRADD; Monoclonal Antibody; TRADD (TNFRSF1A-Associated via Death Domain; Hs.89862; MGC11078) (MaxLight 750); TNFRSF1A-Associated via Death Domain; MGC11078; anti-TRADD antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G3
Specificity
Recognizes TRADD.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-TRADD antibody
FLISA, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TRADD (NP_003780, 203aa-312aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-TRADD antibody
The protein encoded by this gene is a death domain containing adaptor molecule that interacts with TNFRSF1A/TNFR1 and mediates programmed cell death signaling and NF-kappaB activation. This protein binds adaptor protein TRAF2, reduces the recruitment of inhibitor-of-apoptosis proteins (IAPs) by TRAF2, and thus suppresses TRAF2 mediated apoptosis. This protein can also interact with receptor TNFRSF6/FAS and adaptor protein FADD/MORT1, and is involved in the Fas-induced cell death pathway. [provided by RefSeq]
Product Categories/Family for anti-TRADD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,904 Da
NCBI Official Full Name
tumor necrosis factor receptor type 1-associated DEATH domain protein
NCBI Official Synonym Full Names
TNFRSF1A-associated via death domain
NCBI Official Symbol
TRADD
NCBI Official Synonym Symbols
Hs.89862
NCBI Protein Information
tumor necrosis factor receptor type 1-associated DEATH domain protein; TNFR1-associated death domain protein; tumor necrosis factor receptor type 1 associated death domain protein; tumor necrosis factor receptor-1-associated protein
UniProt Protein Name
Tumor necrosis factor receptor type 1-associated DEATH domain protein
UniProt Gene Name
TRADD
UniProt Synonym Gene Names
TNFR1-associated DEATH domain protein
UniProt Entry Name
TRADD_HUMAN

Uniprot Description

TRADD: Adapter molecule for TNFRSF1A/TNFR1 that specifically associates with the cytoplasmic domain of activated TNFRSF1A/TNFR1 mediating its interaction with FADD. Overexpression of TRADD leads to two major TNF-induced responses, apoptosis and activation of NF-kappa-B. Heterodimer with TNFRSF1A/TNFR1. Interacts with DAB2IP, FADD, HIPK2, KRT14, KRT16, KRT17, KRT18, RIPK1, SQSTM1, TRAF1, TRAF2 and TRPC4AP. Found in all examined tissues.

Protein type: Adaptor/scaffold; Apoptosis

Chromosomal Location of Human Ortholog: 16q22

Cellular Component: cytoskeleton; cytoplasm; nucleus; cytosol; receptor complex; lipid raft

Molecular Function: identical protein binding; signal transducer activity; protein binding; protein complex binding; tumor necrosis factor receptor binding; kinase binding; molecular adaptor activity

Biological Process: caspase activation; positive regulation of hair follicle development; positive regulation of I-kappaB kinase/NF-kappaB cascade; induction of apoptosis via death domain receptors; tumor necrosis factor-mediated signaling pathway; protein heterooligomerization; apoptosis; positive regulation of apoptosis; signal transduction; activation of NF-kappaB transcription factor

Similar Products

Product Notes

The TRADD tradd (Catalog #AAA6241161) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TRADD can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRADD tradd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRADD, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.