Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse GHRL Monoclonal Antibody | anti-GHRL antibody

GHRL (Ghrelin/obestatin Prepropeptide, MTLRP, obestatin) (MaxLight 750)

Gene Names
GHRL; MTLRP
Applications
Western Blot
Purity
Purified
Synonyms
GHRL; Monoclonal Antibody; GHRL (Ghrelin/obestatin Prepropeptide; MTLRP; obestatin) (MaxLight 750); Ghrelin/obestatin Prepropeptide; obestatin; anti-GHRL antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F2
Specificity
Recognizes GHRL.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Sequence Length
117
Applicable Applications for anti-GHRL antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GHRL (NP_057446, 24aa-117aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-GHRL antibody
This gene encodes ghrelin-obestatin preproprotein, which generates ghrelin and obestatin. Ghrelin is an endogenous ligand for the growth hormone secretagogue receptor and is involved in regulating growth hormone release. Obestatin was initially reported to be an endogenous ligand for the orphan G protein-coupled receptor GPR39 and was involved in satiety and decreased food intake; however, these findings are controversial. Recent reports show that obestatin is involved in inhibiting thirst and anxiety, improving memory, regulating sleep, affecting cell proliferation, and increasing the secretion of pancreatic juice enzymes. Alternative promoters and alternative splicing result in multiple transcript variants, some of which encode different protein isoforms and some of which do not encode a protein but may regulate the ghrelin-obestatin preproprotein expression. In addition, antisense transcripts for this gene have been identified and may also function in regulation of the ghrelin-obestatin preproprotein expression. [provided by RefSeq]
Product Categories/Family for anti-GHRL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
appetite-regulating hormone isoform 1 preproprotein
NCBI Official Synonym Full Names
ghrelin and obestatin prepropeptide
NCBI Official Symbol
GHRL
NCBI Official Synonym Symbols
MTLRP
NCBI Protein Information
appetite-regulating hormone
UniProt Protein Name
Appetite-regulating hormone
Protein Family
UniProt Gene Name
GHRL
UniProt Synonym Gene Names
MTLRP; Ghrelin
UniProt Entry Name
GHRL_HUMAN

NCBI Description

This gene encodes the ghrelin-obestatin preproprotein that is cleaved to yield two peptides, ghrelin and obestatin. Ghrelin is a powerful appetite stimulant and plays an important role in energy homeostasis. Its secretion is initiated when the stomach is empty, whereupon it binds to the growth hormone secretagogue receptor in the hypothalamus which results in the secretion of growth hormone (somatotropin). Ghrelin is thought to regulate multiple activities, including hunger, reward perception via the mesolimbic pathway, gastric acid secretion, gastrointestinal motility, and pancreatic glucose-stimulated insulin secretion. It was initially proposed that obestatin plays an opposing role to ghrelin by promoting satiety and thus decreasing food intake, but this action is still debated. Recent reports suggest multiple metabolic roles for obestatin, including regulating adipocyte function and glucose metabolism. Alternative splicing results in multiple transcript variants. In addition, antisense transcripts for this gene have been identified and may potentially regulate ghrelin-obestatin preproprotein expression. [provided by RefSeq, Nov 2014]

Uniprot Description

ghrelin: a hormone that binds to the growth hormone secretagogue receptor type 1 (GHSR). Secreted by the stomach

Protein type: Secreted; Cell development/differentiation; Cell cycle regulation; Secreted, signal peptide; Apoptosis

Chromosomal Location of Human Ortholog: 3p26-p25

Cellular Component: extracellular space; endoplasmic reticulum lumen; axon; extracellular region

Molecular Function: growth hormone-releasing hormone activity; G-protein-coupled receptor binding; ghrelin receptor binding; protein tyrosine kinase activator activity

Biological Process: cortisol secretion; negative regulation of circadian sleep/wake cycle, REM sleep; positive regulation of cortisol secretion; hormone-mediated signaling; activation of MAPK activity; response to hormone stimulus; negative regulation of interleukin-6 biosynthetic process; positive regulation of multicellular organism growth; decidualization; positive regulation of adrenocorticotropic hormone secretion; negative regulation of insulin secretion; growth hormone secretion; elevation of cytosolic calcium ion concentration; negative regulation of locomotion; positive regulation of appetite; dendrite development; negative regulation of tumor necrosis factor biosynthetic process; positive regulation of circadian sleep/wake cycle, non-REM sleep; regulation of response to food; gastric acid secretion; positive regulation of insulin secretion; glucose metabolic process; adult feeding behavior; negative regulation of interleukin-1 beta production; regulation of cell proliferation; positive regulation of growth hormone secretion; positive regulation of synaptogenesis; G-protein coupled receptor protein signaling pathway; negative regulation of angiogenesis; cellular protein metabolic process; response to estrogen stimulus; negative regulation of inflammatory response; cartilage development; actin polymerization and/or depolymerization; negative regulation of endothelial cell proliferation; regulation of excitatory postsynaptic membrane potential; negative regulation of apoptosis

Disease: Obesity

Research Articles on GHRL

Similar Products

Product Notes

The GHRL ghrl (Catalog #AAA6238450) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GHRL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GHRL ghrl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GHRL, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.