Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Mouse anti-Human POLR1C Monoclonal Antibody | anti-POLR1C antibody

POLR1C (Polymerase (RNA) I Polypeptide C, 30kD, OTTHUMP00000016470, RNA Polymerase I Subunit, RPA39, RPA40, RPA5, RPAC1) (MaxLight 750)

Gene Names
POLR1C; AC40; RPA5; TCS3; HLD11; RPA39; RPA40; RPAC1; RPC40
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
POLR1C; Monoclonal Antibody; POLR1C (Polymerase (RNA) I Polypeptide C; 30kD; OTTHUMP00000016470; RNA Polymerase I Subunit; RPA39; RPA40; RPA5; RPAC1) (MaxLight 750); anti-POLR1C antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2E11
Specificity
Recognizes human POLR1C.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Sequence Length
346
Applicable Applications for anti-POLR1C antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa1-346 from full-length human POLR1C with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGNQADLFPEGTIRPVHDDILIAQLRPGQEIDLLMHCVKGIGKDHAKFSPVATASYRLLPDITLLEPVEGEAAEELSRCFSPGVIEVQEVQGKKVARVANPRLDTFSREIFRNEKLKKVVRLARVRDHYIFSVESTGVLPPDVLVSEAIKVLMGKCRRFLDELDAVQMD
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-POLR1C antibody
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft By similarity.
Product Categories/Family for anti-POLR1C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Polymerase (RNA) I polypeptide C, 30kDa
NCBI Official Synonym Full Names
RNA polymerase I and III subunit C
NCBI Official Symbol
POLR1C
NCBI Official Synonym Symbols
AC40; RPA5; TCS3; HLD11; RPA39; RPA40; RPAC1; RPC40
NCBI Protein Information
DNA-directed RNA polymerases I and III subunit RPAC1

NCBI Description

The protein encoded by this gene is a subunit of both RNA polymerase I and RNA polymerase III complexes. The encoded protein is part of the Pol core element. Mutations in this gene have been associated with Treacher Collins syndrome (TCS) and hypomyelinating leukodystrophy 11. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]

Research Articles on POLR1C

Similar Products

Product Notes

The POLR1C (Catalog #AAA6236956) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The POLR1C (Polymerase (RNA) I Polypeptide C, 30kD, OTTHUMP00000016470, RNA Polymerase I Subunit, RPA39, RPA40, RPA5, RPAC1) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POLR1C can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the POLR1C for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "POLR1C, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual