Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human UNC5B Monoclonal Antibody | anti-UNC5B antibody

UNC5B (Protein Unc-5 Homolog B, Netrin Receptor UNC5B, Protein Unc-5 Homolog 2, UNC5H2, p53-regulated Receptor for Death and Life Protein 1, P53RDL1, UNQ1883/PRO4326) (MaxLight 750)

Gene Names
UNC5B; UNC5H2; p53RDL1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UNC5B; Monoclonal Antibody; UNC5B (Protein Unc-5 Homolog B; Netrin Receptor UNC5B; Protein Unc-5 Homolog 2; UNC5H2; p53-regulated Receptor for Death and Life Protein 1; P53RDL1; UNQ1883/PRO4326) (MaxLight 750); anti-UNC5B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A9
Specificity
Recognizes human UNC5B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Sequence Length
945
Applicable Applications for anti-UNC5B antibody
FLISA, Western Blot (WB)
Application Notes
FLISA: 1ng/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa27-127 from human UNC5B (NP_734465) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GTDSGSEVLPDSFPSAPAEPLPYFLQEPQDAYIVKNKPVELRCRAFPATQIYFKCNGEWVSQNDHVTQEGLDEATGLRVREVQIEVSRQQVEELFGLEDY
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-UNC5B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
netrin receptor UNC5B isoform 1
NCBI Official Synonym Full Names
unc-5 netrin receptor B
NCBI Official Symbol
UNC5B
NCBI Official Synonym Symbols
UNC5H2; p53RDL1
NCBI Protein Information
netrin receptor UNC5B
UniProt Protein Name
Netrin receptor UNC5B
Protein Family
UniProt Gene Name
UNC5B
UniProt Synonym Gene Names
P53RDL11 PublicationManual assertion based on opinion iniRef.2; p53RDL11 PublicationManual assertion based on opinion iniRef.2

NCBI Description

This gene encodes a member of the netrin family of receptors. This particular protein mediates the repulsive effect of netrin-1 and is a vascular netrin receptor. This encoded protein is also in a group of proteins called dependence receptors (DpRs) which are involved in pro- and anti-apoptotic processes. Many DpRs are involved in embryogenesis and in cancer progression. Two alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

Receptor for netrin required for axon guidance. Mediates axon repulsion of neuronal growth cones in the developing nervous system upon ligand binding. Axon repulsion in growth cones may be caused by its association with DCC that may trigger signaling for repulsion (). Functions as netrin receptor that negatively regulates vascular branching during angiogenesis. Mediates retraction of tip cell filopodia on endothelial growth cones in response to netrin (). It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand (PubMed:12598906). Mediates apoptosis by activating DAPK1. In the absence of NTN1, activates DAPK1 by reducing its autoinhibitory phosphorylation at Ser-308 thereby increasing its catalytic activity ().

Research Articles on UNC5B

Similar Products

Product Notes

The UNC5B unc5b (Catalog #AAA6236032) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UNC5B (Protein Unc-5 Homolog B, Netrin Receptor UNC5B, Protein Unc-5 Homolog 2, UNC5H2, p53-regulated Receptor for Death and Life Protein 1, P53RDL1, UNQ1883/PRO4326) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UNC5B can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). FLISA: 1ng/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UNC5B unc5b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UNC5B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.