Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Synaptotagmin 2 Monoclonal Antibody | anti-SYT2 antibody

Synaptotagmin 2 (Synaptotagmin-2, SYT2, Synaptotagmin II, SytII) (MaxLight 750)

Gene Names
SYT2; CMS7; MYSPC; SytII
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Synaptotagmin 2; Monoclonal Antibody; Synaptotagmin 2 (Synaptotagmin-2; SYT2; Synaptotagmin II; SytII) (MaxLight 750); anti-SYT2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G10
Specificity
Recognizes human SYT2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-SYT2 antibody
FLISA, Western Blot (WB)
Application Notes
FLISA: 0.1ng/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa311-419 from human SYT2 (NP_796376) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKN
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-SYT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
synaptotagmin-2
NCBI Official Synonym Full Names
synaptotagmin 2
NCBI Official Symbol
SYT2
NCBI Official Synonym Symbols
CMS7; MYSPC; SytII
NCBI Protein Information
synaptotagmin-2
UniProt Protein Name
Synaptotagmin-2
Protein Family
UniProt Gene Name
SYT2
UniProt Synonym Gene Names
SytII
UniProt Entry Name
SYT2_HUMAN

NCBI Description

This gene encodes a synaptic vesicle membrane protein. The encoded protein is thought to function as a calcium sensor in vesicular trafficking and exocytosis. Mutations in this gene are associated with myasthenic syndrome, presynaptic, congenital, with or without motor neuropathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]

Uniprot Description

SYT2: May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. Belongs to the synaptotagmin family.

Protein type: Lipid-binding; Membrane protein, integral; Calcium-binding; Vesicle

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: synaptic vesicle membrane; intracellular membrane-bound organelle; plasma membrane; integral to membrane; cell junction

Molecular Function: protein binding; calcium-dependent phospholipid binding; transporter activity; calcium ion binding

Biological Process: transport; pathogenesis

Disease: Myasthenic Syndrome, Presynaptic, Congenital, With Or Without Motor Neuropathy

Research Articles on SYT2

Similar Products

Product Notes

The SYT2 syt2 (Catalog #AAA6235658) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Synaptotagmin 2 (Synaptotagmin-2, SYT2, Synaptotagmin II, SytII) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Synaptotagmin 2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). FLISA: 0.1ng/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SYT2 syt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Synaptotagmin 2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.