Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Phosphoglycerate Mutase 1 Monoclonal Antibody | anti-PGAM1 antibody

Phosphoglycerate Mutase 1 (PGAM1, PGAM-1, PGAMA, BPG-dependent PGAM1, BPG-dependent PGAM-1, OTTHUMP00000059414, PGAM-B, Phosphoglycerate Mutase A, Phosphoglycerate Mutase Isozyme B) (MaxLight 750)

Gene Names
PGAM1; PGAMA; PGAM-B; HEL-S-35
Reactivity
Human
Applications
Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Phosphoglycerate Mutase 1; Monoclonal Antibody; Phosphoglycerate Mutase 1 (PGAM1; PGAM-1; PGAMA; BPG-dependent PGAM1; BPG-dependent PGAM-1; OTTHUMP00000059414; PGAM-B; Phosphoglycerate Mutase A; Phosphoglycerate Mutase Isozyme B) (MaxLight 750); anti-PGAM1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G1-A6
Specificity
Recognizes human PGAM1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Sequence Length
1705
Applicable Applications for anti-PGAM1 antibody
FLISA, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-255 from human PGAM1 (AAH11678) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PGAM1 antibody
PGAM1 can be interconversion of 3- and 2-phosphoglycerate with 2,3-bisphosphoglycerate as the primer of the reaction. It can also catalyze the reaction of EC 5.4.2.4 (synthase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.
Product Categories/Family for anti-PGAM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens phosphoglycerate mutase 1 (brain), mRNA
NCBI Official Synonym Full Names
phosphoglycerate mutase 1
NCBI Official Symbol
PGAM1
NCBI Official Synonym Symbols
PGAMA; PGAM-B; HEL-S-35
NCBI Protein Information
phosphoglycerate mutase 1
Protein Family

NCBI Description

The protein encoded by this gene is a mutase that catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]

Research Articles on PGAM1

Similar Products

Product Notes

The PGAM1 (Catalog #AAA6234491) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Phosphoglycerate Mutase 1 (PGAM1, PGAM-1, PGAMA, BPG-dependent PGAM1, BPG-dependent PGAM-1, OTTHUMP00000059414, PGAM-B, Phosphoglycerate Mutase A, Phosphoglycerate Mutase Isozyme B) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Phosphoglycerate Mutase 1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PGAM1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Phosphoglycerate Mutase 1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.