Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ITGB3BP Monoclonal Antibody | anti-ITGB3BP antibody

ITGB3BP (Integrin beta 3 Binding Protein, Beta-3-endonexin, Centromere Protein R, CENPR, CENP-R, HSU37139, Nuclear Receptor-interacting Factor 3, NRIF3, TAP20) (MaxLight 750)

Gene Names
ITGB3BP; CENPR; NRIF3; TAP20; CENP-R; HSU37139
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ITGB3BP; Monoclonal Antibody; ITGB3BP (Integrin beta 3 Binding Protein; Beta-3-endonexin; Centromere Protein R; CENPR; CENP-R; HSU37139; Nuclear Receptor-interacting Factor 3; NRIF3; TAP20) (MaxLight 750); anti-ITGB3BP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F6
Specificity
Recognizes human ITGB3BP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-ITGB3BP antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100, from ITGB3BP (AAH14385) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTK
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-ITGB3BP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
24,729 Da
NCBI Official Full Name
Homo sapiens integrin beta 3 binding protein (beta3-endonexin), mRNA
NCBI Official Synonym Full Names
integrin subunit beta 3 binding protein
NCBI Official Symbol
ITGB3BP
NCBI Official Synonym Symbols
CENPR; NRIF3; TAP20; CENP-R; HSU37139
NCBI Protein Information
centromere protein R
Protein Family

NCBI Description

This gene encodes a transcriptional coregulator that binds to and enhances the activity of members of the nuclear receptor families, thyroid hormone receptors and retinoid X receptors. This protein also acts as a corepressor of NF-kappaB-dependent signaling. This protein induces apoptosis in breast cancer cells through a caspase 2-mediated signaling pathway. This protein is also a component of the centromere-specific histone H3 variant nucleosome associated complex (CENP-NAC) and may be involved in mitotic progression by recruiting the histone H3 variant CENP-A to the centromere. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]

Research Articles on ITGB3BP

Similar Products

Product Notes

The ITGB3BP (Catalog #AAA6233486) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ITGB3BP (Integrin beta 3 Binding Protein, Beta-3-endonexin, Centromere Protein R, CENPR, CENP-R, HSU37139, Nuclear Receptor-interacting Factor 3, NRIF3, TAP20) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ITGB3BP can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ITGB3BP for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ITGB3BP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.