Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse ATG3 Monoclonal Antibody | anti-ATG3 antibody

ATG3 (ATG3 autophagy Related 3 Homolog (S. cerevisiae), APG3, APG3-LIKE, APG3L, DKFZp564M1178, FLJ22125, MGC15201, PC3-96) (MaxLight 650)

Gene Names
ATG3; APG3; APG3L; PC3-96; APG3-LIKE
Applications
Western Blot
Purity
Purified
Synonyms
ATG3; Monoclonal Antibody; ATG3 (ATG3 autophagy Related 3 Homolog (S. cerevisiae); APG3; APG3-LIKE; APG3L; DKFZp564M1178; FLJ22125; MGC15201; PC3-96) (MaxLight 650); ATG3 autophagy Related 3 Homolog (S. cerevisiae); PC3-96; anti-ATG3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1G3
Specificity
Recognizes ATG3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-ATG3 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ATG3 (NP_071933, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEE
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ATG3 antibody
Autophagy is a process of bulk degradation of cytoplasmic components by the lysosome or vacuole. Human ATG3 displays the same enzymatic characteristics in vitro as yeast Apg3, a protein-conjugating enzyme essential for autophagy (Tanida et al., 2002 [PubMed 11825910]). [supplied by OMIM]
Product Categories/Family for anti-ATG3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,467 Da
NCBI Official Full Name
ubiquitin-like-conjugating enzyme ATG3 isoform 1
NCBI Official Synonym Full Names
autophagy related 3
NCBI Official Symbol
ATG3
NCBI Official Synonym Symbols
APG3; APG3L; PC3-96; APG3-LIKE
NCBI Protein Information
ubiquitin-like-conjugating enzyme ATG3; hApg3; 2610016C12Rik; autophagy-related protein 3; ATG3 autophagy related 3 homolog
UniProt Protein Name
Ubiquitin-like-conjugating enzyme ATG3
Protein Family
UniProt Gene Name
ATG3
UniProt Synonym Gene Names
APG3; APG3L; APG3-like; hApg3
UniProt Entry Name
ATG3_HUMAN

NCBI Description

This gene encodes a ubiquitin-like-conjugating enzyme and is a component of ubiquitination-like systems involved in autophagy, the process of degradation, turnover and recycling of cytoplasmic constituents in eukaryotic cells. This protein is known to play a role in regulation of autophagy during cell death. A pseudogene of this gene is located on chromosome 20. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]

Uniprot Description

ATG3: an E2-like enzyme essential for Apg8p lipidation.

Protein type: Enzyme, cellular metabolism; EC 6.3.2.-; Autophagy; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 3q13.2

Cellular Component: cytoplasmic ubiquitin ligase complex; cytosol

Molecular Function: protein binding; enzyme binding; small conjugating protein ligase activity; APG8 conjugating enzyme activity; APG12 conjugating enzyme activity

Biological Process: mitochondrion degradation; protein ubiquitination; protein modification process; mitochondrial fragmentation during apoptosis; protein targeting to membrane; autophagic vacuole formation

Research Articles on ATG3

Similar Products

Product Notes

The ATG3 atg3 (Catalog #AAA6226600) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ATG3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATG3 atg3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATG3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.