Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse STK4 Monoclonal Antibody | anti-STK4 antibody

STK4 (Serine/Threonine Kinase 4, OTTHUMP00000043418, DJ211D12.2 (Serine/Threonine Kinase 4 (MST1, KRS2)), Kinase Responsive to Stress 2, Mammalian Sterile 20-like 1, Yeast Ste20-like, DKFZp686A2068, KRS2, MST1, YSK3) (MaxLight 650)

Gene Names
STK4; KRS2; MST1; YSK3; TIIAC
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
STK4; Monoclonal Antibody; STK4 (Serine/Threonine Kinase 4; OTTHUMP00000043418; DJ211D12.2 (Serine/Threonine Kinase 4 (MST1; KRS2)); Kinase Responsive to Stress 2; Mammalian Sterile 20-like 1; Yeast Ste20-like; DKFZp686A2068; KRS2; MST1; YSK3) (MaxLight 650); anti-STK4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F4
Specificity
Recognizes human STK4. Species Crossreactivity: mouse and rat
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-STK4 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB), In situ Proximity Ligation Assay
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa391-485 from human STK4 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQ
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-STK4 antibody
The protein encoded by this gene is a cytoplasmic kinase that is structurally similar to the yeast Ste20p kinase, which acts upstream of the stress-induced mitogen-activated protein kinase cascade. The encoded protein can phosphorylate myelin basic protein and undergoes autophosphorylation. A caspase-cleaved fragment of the encoded protein has been shown to be capable of phosphorylating histone H2B. The particular phosphorylation catalyzed by this protein has been correlated with apoptosis, and it's possible that this protein induces the chromatin condensation observed in this process.
Product Categories/Family for anti-STK4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,335 Da
NCBI Official Full Name
serine/threonine-protein kinase 4
NCBI Official Synonym Full Names
serine/threonine kinase 4
NCBI Official Symbol
STK4
NCBI Official Synonym Symbols
KRS2; MST1; YSK3; TIIAC
NCBI Protein Information
serine/threonine-protein kinase 4; MST-1; STE20-like kinase MST1; dJ211D12.2 (serine/threonine kinase 4 (MST1, KRS2)); kinase responsive to stress 2; mammalian STE20-like protein kinase 1; mammalian sterile 20-like 1; serine/threonine-protein kinase Krs-2
UniProt Protein Name
Serine/threonine-protein kinase 4
UniProt Gene Name
STK4
UniProt Synonym Gene Names
KRS2; MST1; MST-1; MST1/N; MST1/C

Uniprot Description

Stress-activated, pro-apoptotic kinase which, following caspase-cleavage, enters the nucleus and induces chromatin condensation followed by internucleosomal DNA fragmentation. Key component of the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. STK3/MST2 and STK4/MST1 are required to repress proliferation of mature hepatocytes, to prevent activation of facultative adult liver stem cells (oval cells), and to inhibit tumor formation (). Phosphorylates 'Ser-14' of histone H2B (H2BS14ph) during apoptosis. Phosphorylates FOXO3 upon oxidative stress, which results in its nuclear translocation and cell death initiation. Phosphorylates MOBKL1A, MOBKL1B and RASSF2. Phosphorylates TNNI3 (cardiac Tn-I) and alters its binding affinity to TNNC1 (cardiac Tn-C) and TNNT2 (cardiac Tn-T). Phosphorylates FOXO1 on 'Ser-212' and regulates its activation and stimulates transcription of PMAIP1 in a FOXO1-dependent manner. Phosphorylates SIRT1 and inhibits SIRT1-mediated p53/TP53 deacetylation, thereby promoting p53/TP53 dependent transcription and apoptosis upon DNA damage. Acts as an inhibitor of PKB/AKT1. Phosphorylates AR on 'Ser-650' and suppresses its activity by intersecting with PKB/AKT1 signaling and antagonizing formation of AR-chromatin complexes.

Similar Products

Product Notes

The STK4 stk4 (Catalog #AAA6226325) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The STK4 (Serine/Threonine Kinase 4, OTTHUMP00000043418, DJ211D12.2 (Serine/Threonine Kinase 4 (MST1, KRS2)), Kinase Responsive to Stress 2, Mammalian Sterile 20-like 1, Yeast Ste20-like, DKFZp686A2068, KRS2, MST1, YSK3) (MaxLight 650) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's STK4 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB), In situ Proximity Ligation Assay. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STK4 stk4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STK4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.