Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SDC2 Monoclonal Antibody | anti-SDC2 antibody

SDC2 (Syndecan-2, SYND2, Fibroglycan, Heparan Sulfate Proteoglycan Core Protein, HSPG, CD362, HSPG1) (MaxLight 650)

Gene Names
SDC2; HSPG; CD362; HSPG1; SYND2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SDC2; Monoclonal Antibody; SDC2 (Syndecan-2; SYND2; Fibroglycan; Heparan Sulfate Proteoglycan Core Protein; HSPG; CD362; HSPG1) (MaxLight 650); anti-SDC2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B2
Specificity
Recognizes human SDC2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-SDC2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa21-131 from human SDC2 (NP_002989) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNV*
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SDC2 antibody
Cell surface proteoglycan that bears heparan sulfate. Regulates dendritic arbor morphogenesis.
Product Categories/Family for anti-SDC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,160 Da
NCBI Official Full Name
syndecan-2
NCBI Official Synonym Full Names
syndecan 2
NCBI Official Symbol
SDC2
NCBI Official Synonym Symbols
HSPG; CD362; HSPG1; SYND2
NCBI Protein Information
syndecan-2; fibroglycan; syndecan proteoglycan 2; heparan sulfate proteoglycan core protein; cell surface-associated heparan sulfate proteoglycan 1; heparan sulfate proteoglycan 1, cell surface-associated
UniProt Protein Name
Syndecan-2
Protein Family
UniProt Gene Name
SDC2
UniProt Synonym Gene Names
HSPG1; SYND2; HSPG
UniProt Entry Name
SDC2_HUMAN

NCBI Description

The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are required for internalization of the HIV-1 tat protein. The syndecan-2 protein functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Altered syndecan-2 expression has been detected in several different tumor types. [provided by RefSeq, Jul 2008]

Uniprot Description

syndecan-2: a heparan sulfate proteoglycan type I membrane protein that belongs to the syndecan proteoglycan family. Preferentially expressed in cells of mesenchymal origin. Is tyrosine phosphorylated and forms a complex with EphB2 in mouse brain. Plays a role in mediating adhesion and proliferation of colon carcinoma cells.

Protein type: Cell adhesion; Cell surface; Membrane protein, integral; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 8q22-q23

Cellular Component: lysosomal lumen; cell soma; Golgi lumen; integral to membrane; plasma membrane; synapse

Molecular Function: protein binding; PDZ domain binding

Biological Process: axon guidance; phototransduction, visible light; extracellular matrix organization and biogenesis; wound healing; glycosaminoglycan metabolic process; dendrite morphogenesis; regulation of dendrite morphogenesis; pathogenesis; response to caffeine; chondroitin sulfate metabolic process; glycosaminoglycan biosynthetic process; glycosaminoglycan catabolic process; carbohydrate metabolic process; ephrin receptor signaling pathway; response to hypoxia; retinoid metabolic process

Research Articles on SDC2

Similar Products

Product Notes

The SDC2 sdc2 (Catalog #AAA6224533) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SDC2 (Syndecan-2, SYND2, Fibroglycan, Heparan Sulfate Proteoglycan Core Protein, HSPG, CD362, HSPG1) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SDC2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SDC2 sdc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SDC2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.