Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human RBAF600 Monoclonal Antibody | anti-RBAF600 antibody

RBAF600 (E3 Ubiquitin-protein Ligase UBR4, N-recognin-4, Zinc Finger UBR1-type Protein 1, Retinoblastoma-associated Factor of 600kD, p600, 600kD Retinoblastoma Protein-associated Factor, UBR4, KIAA0462, KIAA1307, ZUBR1) (MaxLight 650)

Gene Names
UBR4; p600; ZUBR1; RBAF600
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RBAF600; Monoclonal Antibody; RBAF600 (E3 Ubiquitin-protein Ligase UBR4; N-recognin-4; Zinc Finger UBR1-type Protein 1; Retinoblastoma-associated Factor of 600kD; p600; 600kD Retinoblastoma Protein-associated Factor; UBR4; KIAA0462; KIAA1307; ZUBR1) (MaxLight 650); anti-RBAF600 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2D12
Specificity
Recognizes human RBAF600.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
5183
Applicable Applications for anti-RBAF600 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa94-191 from RBAF600 (NP_065816) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RNQLQSVAAACKVLIEFSLLRLENPDEACAVSQKHLILLIKGLCTGCSRLDRTEIITFTAMMKSAKLPQTVKTLSDVEDQKELASPVSPELRQKEVQ*
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-RBAF600 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
E3 ubiquitin-protein ligase UBR4
NCBI Official Synonym Full Names
ubiquitin protein ligase E3 component n-recognin 4
NCBI Official Symbol
UBR4
NCBI Official Synonym Symbols
p600; ZUBR1; RBAF600
NCBI Protein Information
E3 ubiquitin-protein ligase UBR4
UniProt Protein Name
E3 ubiquitin-protein ligase UBR4
UniProt Gene Name
UBR4
UniProt Synonym Gene Names
KIAA0462; KIAA1307; RBAF600; ZUBR1; RBAF600; p600

NCBI Description

The protein encoded by this gene is an E3 ubiquitin-protein ligase that interacts with the retinoblastoma-associated protein in the nucleus and with calcium-bound calmodulin in the cytoplasm. The encoded protein appears to be a cytoskeletal component in the cytoplasm and part of the chromatin scaffold in the nucleus. In addition, this protein is a target of the human papillomavirus type 16 E7 oncoprotein. [provided by RefSeq, Aug 2010]

Uniprot Description

E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. Together with clathrin, forms meshwork structures involved in membrane morphogenesis and cytoskeletal organization. Regulates integrin-mediated signaling. May play a role in activation of FAK in response to cell-matrix interactions. Mediates ubiquitination of ACLY, leading to its subsequent degradation.

Research Articles on RBAF600

Similar Products

Product Notes

The RBAF600 ubr4 (Catalog #AAA6224229) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RBAF600 (E3 Ubiquitin-protein Ligase UBR4, N-recognin-4, Zinc Finger UBR1-type Protein 1, Retinoblastoma-associated Factor of 600kD, p600, 600kD Retinoblastoma Protein-associated Factor, UBR4, KIAA0462, KIAA1307, ZUBR1) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RBAF600 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RBAF600 ubr4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RBAF600, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.