Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human AMY2B Monoclonal Antibody | anti-AMY2B antibody

AMY2B (Alpha-amylase 2B, 1,4-alpha-D-glucan Glucanohydrolase 2B, Carcinoid alpha-amylase) (MaxLight 650)

Gene Names
AMY2B; HXA; AMY2; AMY3
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AMY2B; Monoclonal Antibody; AMY2B (Alpha-amylase 2B; 1; 4-alpha-D-glucan Glucanohydrolase 2B; Carcinoid alpha-amylase) (MaxLight 650); anti-AMY2B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B12
Specificity
Recognizes human AMY2B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-AMY2B antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa19-117 from human AMY2B (NP_066188) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHM
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-AMY2B antibody
Endohydrolysis of (1->4)-alpha-D-glucosidic linkages in polysaccharides containing three or more (1->4)-alpha-linked D-glucose units.
Product Categories/Family for anti-AMY2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
280
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
alpha-amylase 2B
NCBI Official Synonym Full Names
amylase alpha 2B (pancreatic)
NCBI Official Symbol
AMY2B
NCBI Official Synonym Symbols
HXA; AMY2; AMY3
NCBI Protein Information
alpha-amylase 2B
UniProt Protein Name
Alpha-amylase 2B
Protein Family
UniProt Gene Name
AMY2B
UniProt Entry Name
AMY2B_HUMAN

NCBI Description

Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the pancreas. [provided by RefSeq, Jun 2013]

Uniprot Description

AMY2B: Monomer. Belongs to the glycosyl hydrolase 13 family.

Protein type: Carbohydrate Metabolism - starch and sucrose; Secreted, signal peptide; EC 3.2.1.1; Secreted; Hydrolase

Chromosomal Location of Human Ortholog: 1p21

Molecular Function: alpha-amylase activity; metal ion binding

Biological Process: carbohydrate metabolic process; digestion

Research Articles on AMY2B

Similar Products

Product Notes

The AMY2B amy2b (Catalog #AAA6220873) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AMY2B (Alpha-amylase 2B, 1,4-alpha-D-glucan Glucanohydrolase 2B, Carcinoid alpha-amylase) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AMY2B can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AMY2B amy2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AMY2B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.