Mouse CHL1 Monoclonal Antibody | anti-CHL1 antibody
CHL1 (Cell Adhesion Molecule with Homology to L1CAM (close Homolog of L1), CALL, FLJ44930, L1CAM2, MGC132578) (MaxLight 550)
Gene Names
CHL1; CALL; L1CAM2
Applications
Western Blot
Purity
Purified
Synonyms
CHL1; Monoclonal Antibody; CHL1 (Cell Adhesion Molecule with Homology to L1CAM (close Homolog of L1); CALL; FLJ44930; L1CAM2; MGC132578) (MaxLight 550); Cell Adhesion Molecule with Homology to L1CAM (close Homolog of L1); MGC132578; anti-CHL1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H5
Specificity
Recognizes CHL1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-CHL1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CHL1 (NP_006605, 26aa-135aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIEFIVPSVPKFPK
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CHL1 antibody
The protein encoded by this gene is a member of the L1 gene family of neural cell adhesion molecules. It is a neural recognition molecule that may be involved in signal transduction pathways. The deletion of one copy of this gene may be responsible for mental defects in patients with 3p- syndrome. Several alternatively spliced transcript variants of this gene have been described, but their full length nature is not known. [provided by RefSeq]
Product Categories/Family for anti-CHL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
136,698 Da
NCBI Official Full Name
neural cell adhesion molecule L1-like protein isoform 1
NCBI Official Synonym Full Names
cell adhesion molecule L1-like
NCBI Official Symbol
CHL1
NCBI Official Synonym Symbols
CALL; L1CAM2
NCBI Protein Information
neural cell adhesion molecule L1-like protein; L1 cell adhesion molecule 2; cell adhesion molecule with homology to L1CAM (close homolog of L1); cell adhesion molecule with homology to L1CAM (close homologue of L1)
UniProt Protein Name
Neural cell adhesion molecule L1-like protein
Protein Family
UniProt Gene Name
CHL1
UniProt Synonym Gene Names
CALL
Uniprot Description
CHL1: Extracellular matrix and cell adhesion protein that plays a role in nervous system development and in synaptic plasticity. Both soluble and membranous forms promote neurite outgrowth of cerebellar and hippocampal neurons and suppress neuronal cell death. Plays a role in neuronal positioning of pyramidal neurons and in regulation of both the number of interneurons and the efficacy of GABAergic synapses. May play a role in regulating cell migration in nerve regeneration and cortical development. Potentiates integrin-dependent cell migration towards extracellular matrix proteins. Recruits ANK3 to the plasma membrane. Belongs to the immunoglobulin superfamily. L1/neurofascin/NgCAM family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Cell adhesion; Cell development/differentiation; Extracellular matrix; Membrane protein, integral; Motility/polarity/chemotaxis
Chromosomal Location of Human Ortholog: 3p26.3
Biological Process: signal transduction
Similar Products
Product Notes
The CHL1 chl1 (Catalog #AAA6216315) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CHL1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CHL1 chl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CHL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
