Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SLC5A3 Monoclonal Antibody | anti-SLC5A3 antibody

SLC5A3 (Sodium/Myo-inositol Cotransporter, Na(+)/Myo-inositol Cotransporter, Sodium/Myo-inositol Transporter 1, SMIT1, Solute Carrier Family 5 Member 3) (MaxLight 550)

Gene Names
SLC5A3; BCW2; SMIT; SMIT1; SMIT2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC5A3; Monoclonal Antibody; SLC5A3 (Sodium/Myo-inositol Cotransporter; Na(+)/Myo-inositol Cotransporter; Sodium/Myo-inositol Transporter 1; SMIT1; Solute Carrier Family 5 Member 3) (MaxLight 550); anti-SLC5A3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3A6
Specificity
Recognizes human SLC5A3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-SLC5A3 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa533-642 from human SLC5A3 (NP_008864) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TPPPTKEQIRTTTFWSKKNLVVKENCSPKEEPYKMQEKSILRCSENNETINHIIPNGKSEDSIKGLQPEDVNLLVTCREEGNPVASLGHSEAETPVDAYSNGQAALMGE*
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SLC5A3 antibody
Prevents intracellular accumulation of high concentrations of myo-inositol (an osmolyte) that result in impairment of cellular function.
Product Categories/Family for anti-SLC5A3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
79,694 Da
NCBI Official Full Name
sodium/myo-inositol cotransporter
NCBI Official Synonym Full Names
solute carrier family 5 member 3
NCBI Official Symbol
SLC5A3
NCBI Official Synonym Symbols
BCW2; SMIT; SMIT1; SMIT2
NCBI Protein Information
sodium/myo-inositol cotransporter
UniProt Protein Name
Sodium/myo-inositol cotransporter
UniProt Gene Name
SLC5A3
UniProt Synonym Gene Names
Na(+)/myo-inositol cotransporter; SMIT1
UniProt Entry Name
SC5A3_HUMAN

Uniprot Description

SLC5A3: a sodium/myo-inositol cotransporter. An integral membrane protein. Prevents intracellular accumulation of high concentrations of myo-inositol (an osmolyte) that result in impairment of cellular function. Belongs to the sodium:solute symporter (SSF) family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Transporter, SLC family; Transporter

Chromosomal Location of Human Ortholog: 21q22.12

Cellular Component: integral to plasma membrane; integral to membrane; plasma membrane

Molecular Function: myo-inositol:sodium symporter activity

Biological Process: regulation of respiratory gaseous exchange; transport; inositol metabolic process; myo-inositol transport; sodium ion transport; transmembrane transport; peripheral nervous system development

Research Articles on SLC5A3

Similar Products

Product Notes

The SLC5A3 slc5a3 (Catalog #AAA6214050) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC5A3 (Sodium/Myo-inositol Cotransporter, Na(+)/Myo-inositol Cotransporter, Sodium/Myo-inositol Transporter 1, SMIT1, Solute Carrier Family 5 Member 3) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC5A3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC5A3 slc5a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC5A3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.