Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human MAGEB6 Monoclonal Antibody | anti-MAGEB6 antibody

MAGEB6 (Melanoma-associated Antigen B6, Cancer/Testis Antigen 3.4, CT3.4, MAGE-B6 Antigen, FLJ40242) (MaxLight 550)

Gene Names
MAGEB6; CT3.4; MAGE-B6; MAGEB6A
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAGEB6; Monoclonal Antibody; MAGEB6 (Melanoma-associated Antigen B6; Cancer/Testis Antigen 3.4; CT3.4; MAGE-B6 Antigen; FLJ40242) (MaxLight 550); anti-MAGEB6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C11
Specificity
Recognizes human MAGEB6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-MAGEB6 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa135-245 from human MAGEB6 (NP_775794) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SPSTSHDVSVPQESQGASPTGSPDAGVSGSKYDVAAEGEDEESVSASQKAIIFKRLSKDAVKKKACTLAQFLQKKFEKKESILKADMLKCVRREYKPYFPQILNRTSQHL
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-MAGEB6 antibody
Expressed in testis. Not expressed in other normal tissues, but is expressed in tumors of different histological origins.
Product Categories/Family for anti-MAGEB6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,992 Da
NCBI Official Full Name
melanoma-associated antigen B6
NCBI Official Synonym Full Names
melanoma antigen family B, 6
NCBI Official Symbol
MAGEB6
NCBI Official Synonym Symbols
CT3.4; MAGE-B6; MAGEB6A
NCBI Protein Information
melanoma-associated antigen B6; MAGE-B6 antigen; cancer/testis antigen 3.4; cancer/testis antigen family 3, member 4
UniProt Protein Name
Melanoma-associated antigen B6
UniProt Gene Name
MAGEB6
UniProt Synonym Gene Names
CT3.4
UniProt Entry Name
MAGB6_HUMAN

NCBI Description

This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. This gene is expressed in testis, and in a significant fraction of tumors of various histological types. The MAGEB genes are clustered on chromosome Xp22-p21. [provided by RefSeq, Jul 2008]

Similar Products

Product Notes

The MAGEB6 mageb6 (Catalog #AAA6212397) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAGEB6 (Melanoma-associated Antigen B6, Cancer/Testis Antigen 3.4, CT3.4, MAGE-B6 Antigen, FLJ40242) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAGEB6 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAGEB6 mageb6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAGEB6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.