Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human KCNK10 Monoclonal Antibody | anti-KCNK10 antibody

KCNK10 (TREK2, Potassium Channel Subfamily K Member 10, Outward Rectifying Potassium Channel Protein TREK-2, TREK-2 K(+) Channel Subunit, FLJ43399, K2p10.1, TREK-2) (MaxLight 550)

Gene Names
KCNK10; TREK2; TREK-2; K2p10.1; PPP1R97
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KCNK10; Monoclonal Antibody; KCNK10 (TREK2; Potassium Channel Subfamily K Member 10; Outward Rectifying Potassium Channel Protein TREK-2; TREK-2 K(+) Channel Subunit; FLJ43399; K2p10.1; TREK-2) (MaxLight 550); anti-KCNK10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1C1
Specificity
Recognizes human KCNK10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-KCNK10 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa439-539 from human KCNK10 (NP_066984) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEKKEEETEKMCNSDNSSTAMLTDCIQQHAELENGMIPTDTKDREPENNSLLEDRN
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-KCNK10 antibody
Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K+ currents. Activated by arachidonic acid and other naturally occurring unsaturated free fatty acids.
Product Categories/Family for anti-KCNK10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
potassium channel subfamily K member 10 isoform 1
NCBI Official Synonym Full Names
potassium two pore domain channel subfamily K member 10
NCBI Official Symbol
KCNK10
NCBI Official Synonym Symbols
TREK2; TREK-2; K2p10.1; PPP1R97
NCBI Protein Information
potassium channel subfamily K member 10
UniProt Protein Name
Potassium channel subfamily K member 10
UniProt Gene Name
KCNK10
UniProt Synonym Gene Names
TREK2

NCBI Description

The protein encoded by this gene belongs to the family of potassium channel proteins containing two pore-forming P domains. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations, and is stimulated strongly by arachidonic acid and to a lesser degree by membrane stretching, intracellular acidification, and general anaesthetics. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Sep 2008]

Uniprot Description

TREK-2: Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K(+) currents. Activated by arachidonic acid and other naturally occurring unsaturated free fatty acids. Belongs to the two pore domain potassium channel (TC 1.A.1.8) family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Channel, potassium; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 14q31.3

Cellular Component: integral component of plasma membrane; plasma membrane

Molecular Function: potassium channel activity; potassium ion leak channel activity; voltage-gated ion channel activity

Biological Process: memory; signal transduction; stabilization of membrane potential; transport

Research Articles on KCNK10

Similar Products

Product Notes

The KCNK10 kcnk10 (Catalog #AAA6212182) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KCNK10 (TREK2, Potassium Channel Subfamily K Member 10, Outward Rectifying Potassium Channel Protein TREK-2, TREK-2 K(+) Channel Subunit, FLJ43399, K2p10.1, TREK-2) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KCNK10 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KCNK10 kcnk10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KCNK10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.