Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human HECW2 Monoclonal Antibody | anti-HECW2 antibody

HECW2 (KIAA1301, NEDL2, E3 Ubiquitin-protein Ligase HECW2, HECT, C2 and WW Domain-containing Protein 2, NEDD4-like E3 Ubiquitin-protein Ligase 2, DKFZp686M17164) (MaxLight 550)

Gene Names
HECW2; NEDL2; NDHSAL
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HECW2; Monoclonal Antibody; HECW2 (KIAA1301; NEDL2; E3 Ubiquitin-protein Ligase HECW2; HECT; C2 and WW Domain-containing Protein 2; NEDD4-like E3 Ubiquitin-protein Ligase 2; DKFZp686M17164) (MaxLight 550); anti-HECW2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
5H1
Specificity
Recognizes human HECW2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Sequence Length
1572
Applicable Applications for anti-HECW2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa637-746 from human HECW2 (NP_065811) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DLECADSSCNESVTTQLSSVDTRCSSLESARFPETPAFSSQEEEDGACAAEPTSSGPAEGSQESVCTAGSLPVVQVPSGEDEGPGAESATVPDQEELGEVWQRRGSLEG
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-HECW2 antibody
E3 ubiquitin-protein ligase that mediates ubiquitination of TP73. Acts to stabilize TP73 and enhance activation of transcription by TP73.
Product Categories/Family for anti-HECW2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
E3 ubiquitin-protein ligase HECW2 isoform 1
NCBI Official Synonym Full Names
HECT, C2 and WW domain containing E3 ubiquitin protein ligase 2
NCBI Official Symbol
HECW2
NCBI Official Synonym Symbols
NEDL2; NDHSAL
NCBI Protein Information
E3 ubiquitin-protein ligase HECW2
UniProt Protein Name
E3 ubiquitin-protein ligase HECW2
UniProt Gene Name
HECW2
UniProt Synonym Gene Names
KIAA1301; NEDL2
UniProt Entry Name
HECW2_HUMAN

NCBI Description

This gene encodes a member of a family of E3 ubiquitin ligases which plays an important role in the proliferation, migration and differentiation of neural crest cells as a regulator of glial cell line-derived neurotrophic factor (GDNF)/Ret signaling. This gene also plays an important role in angiogenesis through stabilization of endothelial cell-to-cell junctions as a regulator of angiomotin-like 1 stability. The encoded protein contains an N-terminal calcium/lipid-binding (C2) domain involved in membrane targeting, two-four WW domains responsible for cellular localization and substrate recognition, and a C-terminal homologous with E6-associated protein C-terminus (HECT) catalytic domain. Naturally occurring mutations in this gene are associated with neurodevelopmental delay, hypotonia, and epilepsy. The decreased expression of this gene in the aganglionic colon is associated with Hirschsprung's disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2017]

Uniprot Description

HECW2: E3 ubiquitin-protein ligase that mediates ubiquitination of TP73. Acts to stabilize TP73 and enhance activation of transcription by TP73. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system; Ligase; EC 6.3.2.19; EC 6.3.2.-; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 2q32.3

Cellular Component: cytoplasm; nucleus

Molecular Function: ubiquitin-protein ligase activity; ligase activity

Biological Process: protein ubiquitination during ubiquitin-dependent protein catabolic process

Research Articles on HECW2

Similar Products

Product Notes

The HECW2 hecw2 (Catalog #AAA6211857) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HECW2 (KIAA1301, NEDL2, E3 Ubiquitin-protein Ligase HECW2, HECT, C2 and WW Domain-containing Protein 2, NEDD4-like E3 Ubiquitin-protein Ligase 2, DKFZp686M17164) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HECW2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HECW2 hecw2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HECW2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.