Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human, Mouse GLYCTK Monoclonal Antibody | anti-GLYCTK antibody

GLYCTK (Glycerate Kinase, CG9886-like, HBeAg-binding Protein 4, HBEBP4, HBeAgBP4A, HBEBP2, LP5910) (MaxLight 550)

Gene Names
GLYCTK; HBEBP2; HBEBP4; HBeAgBP4A
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GLYCTK; Monoclonal Antibody; GLYCTK (Glycerate Kinase; CG9886-like; HBeAg-binding Protein 4; HBEBP4; HBeAgBP4A; HBEBP2; LP5910) (MaxLight 550); anti-GLYCTK antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B5
Specificity
Recognizes human GLYCTK. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Sequence Length
523
Applicable Applications for anti-GLYCTK antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa332-431 from human GLYCTK (NP_660305) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VLSAAMQGDVKSMAQFYGLLAHVARTRLTPSMAGASVEEDAQLHELAAELQIPDLQLEEALETMAWGRGPVCLLAGGEPTVQLQGSGRGGRNQELALRV
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-GLYCTK antibody
This locus encodes a member of the glycerate kinase type-2 family. The encoded enzyme catalyzes the phosphorylation of (R)-glycerate and may be involved in serine degradation and fructose metabolism. Decreased activity of the encoded enzyme may be associated with the disease D-glyceric aciduria. Alternatively spliced transcript variants have been described.
Product Categories/Family for anti-GLYCTK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
glycerate kinase isoform 1
NCBI Official Synonym Full Names
glycerate kinase
NCBI Official Symbol
GLYCTK
NCBI Official Synonym Symbols
HBEBP2; HBEBP4; HBeAgBP4A
NCBI Protein Information
glycerate kinase
UniProt Protein Name
Glycerate kinase
UniProt Gene Name
GLYCTK
UniProt Synonym Gene Names
HBEBP4
UniProt Entry Name
GLCTK_HUMAN

NCBI Description

This locus encodes a member of the glycerate kinase type-2 family. The encoded enzyme catalyzes the phosphorylation of (R)-glycerate and may be involved in serine degradation and fructose metabolism. Decreased activity of the encoded enzyme may be associated with the disease D-glyceric aciduria. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2009]

Uniprot Description

GLYCTK: Defects in GLYCTK are the cause of D-glyceric aciduria (D-GA). D-GA is a rare metabolic disease characterized by chronic metabolic acidosis and a highly variable clinical phenotype. Clinical features range from an encephalopathic presentation with seizures, microcephaly, severe mental retardation and early death, to milder manifestations with only speech delay or even normal development. Belongs to the glycerate kinase type-2 family. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Lipid Metabolism - glycerolipid; Carbohydrate Metabolism - glyoxylate and dicarboxylate; EC 2.7.1.31; Kinase, other; Amino Acid Metabolism - glycine, serine and threonine

Chromosomal Location of Human Ortholog: 3p21.1

Cellular Component: mitochondrion; cytoplasm

Molecular Function: protein binding; glycerate kinase activity; ATP binding

Biological Process: protein amino acid phosphorylation

Disease: D-glyceric Aciduria

Research Articles on GLYCTK

Similar Products

Product Notes

The GLYCTK glyctk (Catalog #AAA6211707) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GLYCTK (Glycerate Kinase, CG9886-like, HBeAg-binding Protein 4, HBEBP4, HBeAgBP4A, HBEBP2, LP5910) (MaxLight 550) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's GLYCTK can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GLYCTK glyctk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GLYCTK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.