Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human FDPS Monoclonal Antibody | anti-FDPS antibody

FDPS (Farnesyl Pyrophosphate Synthase, FPP Synthase, FPS, Farnesyl Diphosphate Synthase, FPS, KIAA1293) (MaxLight 550)

Gene Names
FDPS; FPS; FPPS; POROK9
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FDPS; Monoclonal Antibody; FDPS (Farnesyl Pyrophosphate Synthase; FPP Synthase; FPS; Farnesyl Diphosphate Synthase; KIAA1293) (MaxLight 550); anti-FDPS antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A6
Specificity
Recognizes human FDPS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-FDPS antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa320-419 from human FDPS (NP_001995.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKEAEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-FDPS antibody
The isoprene biosynthetic pathway supply the cell with cholesterol, ubiquinone, and various nonsterol metabolites. The farnesylpyrophosphate synthetase enzyme catalyzes the formation of geranyl and farnesylpyrophosphate from isopentenylpyrophosphate and dimethylallyl pyrophosphate. Analysis of FDPS activity and protein in rat liver, accompanied by immunofluorescence and immunoelectron microscopy studies, demonstrated that FDPS is predominantly localized in peroxisomes.1 Liver tissue from patients with the peroxisomal deficiency diseases Zellweger syndrome and neonatal adrenoleukodystrophy exhibit diminished activities of FDPS and subsequent isoprenoid synthesis.
Product Categories/Family for anti-FDPS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,532 Da
NCBI Official Full Name
farnesyl pyrophosphate synthase isoform a
NCBI Official Synonym Full Names
farnesyl diphosphate synthase
NCBI Official Symbol
FDPS
NCBI Official Synonym Symbols
FPS; FPPS; POROK9
NCBI Protein Information
farnesyl pyrophosphate synthase
UniProt Protein Name
Farnesyl pyrophosphate synthase
UniProt Gene Name
FDPS
UniProt Synonym Gene Names
FPS; KIAA1293; FPP synthase; FPS
UniProt Entry Name
FPPS_HUMAN

NCBI Description

This gene encodes an enzyme that catalyzes the production of geranyl pyrophosphate and farnesyl pyrophosphate from isopentenyl pyrophosphate and dimethylallyl pyrophosphate. The resulting product, farnesyl pyrophosphate, is a key intermediate in cholesterol and sterol biosynthesis, a substrate for protein farnesylation and geranylgeranylation, and a ligand or agonist for certain hormone receptors and growth receptors. Drugs that inhibit this enzyme prevent the post-translational modifications of small GTPases and have been used to treat diseases related to bone resorption. Multiple pseudogenes have been found on chromosomes 1, 7, 14, 15, 21 and X. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2008]

Uniprot Description

FDPS: Key enzyme in isoprenoid biosynthesis which catalyzes the formation of farnesyl diphosphate (FPP), a precursor for several classes of essential metabolites including sterols, dolichols, carotenoids, and ubiquinones. FPP also serves as substrate for protein farnesylation and geranylgeranylation. Catalyzes the sequential condensation of isopentenyl pyrophosphate with the allylic pyrophosphates, dimethylallyl pyrophosphate, and then with the resultant geranylpyrophosphate to the ultimate product farnesyl pyrophosphate. Belongs to the FPP/GGPP synthase family.

Protein type: Secondary Metabolites Metabolism - terpenoid backbone biosynthesis; Transferase; EC 2.5.1.1; EC 2.5.1.10; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 1q22

Cellular Component: nucleoplasm; mitochondrion; cytoplasm; cytosol

Molecular Function: geranyltranstransferase activity; dimethylallyltranstransferase activity; metal ion binding

Biological Process: viral reproduction; geranyl diphosphate biosynthetic process; farnesyl diphosphate biosynthetic process; cholesterol biosynthetic process

Research Articles on FDPS

Similar Products

Product Notes

The FDPS fdps (Catalog #AAA6211490) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FDPS (Farnesyl Pyrophosphate Synthase, FPP Synthase, FPS, Farnesyl Diphosphate Synthase, FPS, KIAA1293) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FDPS can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FDPS fdps for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FDPS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.