Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ASZ1 Monoclonal Antibody | anti-ASZ1 antibody

ASZ1 (Ankyrin Repeat, SAM and Basic Leucine Zipper Domain-containing Protein 1, Ankyrin-like Protein 1, Germ Cell-specific Ankyrin, SAM and Basic Leucine Zipper Domain-containing Protein, ALP1, ANKL1, C7orf7, GASZ, MGC26634, Orf3, CT1.19) (MaxLight 550)

Gene Names
ASZ1; ALP1; GASZ; Orf3; ANKL1; C7orf7; CT1.19
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ASZ1; Monoclonal Antibody; ASZ1 (Ankyrin Repeat; SAM and Basic Leucine Zipper Domain-containing Protein 1; Ankyrin-like Protein 1; Germ Cell-specific Ankyrin; SAM and Basic Leucine Zipper Domain-containing Protein; ALP1; ANKL1; C7orf7; GASZ; MGC26634; Orf3; CT1.19) (MaxLight 550); anti-ASZ1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3C9
Specificity
Recognizes human ASZ1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-ASZ1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa127-235 from human ASZ1 (NP_570124) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLL
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ASZ1 antibody
Plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Its association with pi-bodies suggests a participation in the primary piRNAs metabolic process. Required prior to the pachytene stage to facilitate the production of multiple types of piRNAs, including those associated with repeats involved in regulation of retrotransposons. May act by mediating protein-protein interactions during germ cell maturation.
Product Categories/Family for anti-ASZ1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 isoform 1
NCBI Official Synonym Full Names
ankyrin repeat, SAM and basic leucine zipper domain containing 1
NCBI Official Symbol
ASZ1
NCBI Official Synonym Symbols
ALP1; GASZ; Orf3; ANKL1; C7orf7; CT1.19
NCBI Protein Information
ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1
UniProt Protein Name
Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1
UniProt Gene Name
ASZ1
UniProt Synonym Gene Names
ALP1; ANKL1; C7orf7; GASZ
UniProt Entry Name
ASZ1_HUMAN

Uniprot Description

ASZ1: Plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Its association with pi-bodies suggests a participation in the primary piRNAs metabolic process. Required prior to the pachytene stage to facilitate the production of multiple types of piRNAs, including those associated with repeats involved in regulation of retrotransposons. May act by mediating protein-protein interactions during germ cell maturation.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 7q31.2

Cellular Component: cytoplasm

Molecular Function: signal transducer activity

Biological Process: DNA methylation during gametogenesis; multicellular organismal development; gene expression; RNA-mediated gene silencing; spermatogenesis; male meiosis; cell differentiation; signal transduction

Research Articles on ASZ1

Similar Products

Product Notes

The ASZ1 asz1 (Catalog #AAA6210318) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ASZ1 (Ankyrin Repeat, SAM and Basic Leucine Zipper Domain-containing Protein 1, Ankyrin-like Protein 1, Germ Cell-specific Ankyrin, SAM and Basic Leucine Zipper Domain-containing Protein, ALP1, ANKL1, C7orf7, GASZ, MGC26634, Orf3, CT1.19) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ASZ1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ASZ1 asz1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ASZ1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.